PDB entry 5kza

View 5kza on RCSB PDB site
Description: Crystal structure of the Rous sarcoma virus matrix protein (aa 2-102). Space group I41
Class: viral protein
Keywords: Viral Protein; Matrix Protein; Membrane Associated Protein, VIRAL PROTEIN
Deposited on 2016-07-24, released 2017-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-26, with a file datestamp of 2017-07-21.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virus Matrix Protein
    Species: Rous sarcoma virus (strain Prague C) [TaxId:11888]
    Gene: gag-pro-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5kzaa1, d5kzaa2
  • Heterogens: NO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kzaA (A:)
    sefeavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaal
    sqramilgksgelktwglvlgalkaareeqvtseqakfwlglgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kzaA (A:)
    sefeavikvissacktycgktspskkeigamlsllqkegllmspsdlyspgswdpitaal
    sqramilgksgelktwglvlgalkaareeqvtse