PDB entry 5kyv

View 5kyv on RCSB PDB site
Description: Structure of Photinus pyralis Luciferase green shifted light emitting variant
Class: oxidoreductase
Keywords: adenylation forming enzyme, ligase, OXIDOREDUCTASE
Deposited on 2016-07-22, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Luciferin 4-monooxygenase
    Species: Photinus pyralis [TaxId:7054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08659
      • engineered mutation (240)
      • engineered mutation (245)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d5kyva_
  • Chain 'B':
    Compound: Luciferin 4-monooxygenase
    Species: Photinus pyralis [TaxId:7054]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08659 (Start-549)
      • engineered mutation (240)
      • engineered mutation (245)
      • engineered mutation (249)
    Domains in SCOPe 2.07: d5kyvb_
  • Heterogens: SLU, TLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kyvA (A:)
    medaknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfems
    vrlaeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmni
    sqptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneyd
    fvpesfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsv
    ipfhhafgmsttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstl
    idkydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpg
    avgkvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhs
    gdiaywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagel
    paavvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireili
    kakkggkskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyvA (A:)
    aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
    aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
    tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
    esfdrdktialimnsslpkgvalphrtacvrfshardpifgnqiipdtailsvipfhhaf
    gmsttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydls
    nlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgkvvp
    ffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdiaywd
    edehffivdrlkslikykgyqvapaelesillqhfdagvaglpdddagelpaavvvlktm
    tekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kyvB (B:)
    medaknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfems
    vrlaeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmni
    sqptvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneyd
    fvpesfdrdktialimnssgstglpkgvalphrtacvrfshardpifgnqiipdtailsv
    ipfhhafgmsttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstl
    idkydlsnlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpg
    avgkvvpffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhs
    gdiaywdedehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagel
    paavvvlehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireili
    kakkggkskl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyvB (B:)
    aknikkgpapfypledgtageqlhkamkryalvpgtiaftdahievnityaeyfemsvrl
    aeamkryglntnhrivvcsenslqffmpvlgalfigvavapandiynerellnsmnisqp
    tvvfvskkglqkilnvqkklpiiqkiiimdsktdyqgfqsmytfvtshlppgfneydfvp
    esfdrdktialimnsslpkgvalphrtacvrfshardpifgnqiipdtailsvipfhhaf
    gmsttlgylicgfrvvlmyrfeeelflrslqdykiqsallvptlfsffakstlidkydls
    nlheiasggaplskevgeavakrfhlpgirqgygltettsailitpegddkpgavgkvvp
    ffeakvvdldtgktlgvnqrgelcvrgpmimsgyvnnpeatnalidkdgwlhsgdiaywd
    edehffivdrlkslikykgyqvapaelesillqhpnifdagvaglpdddagelpaavvvl
    ehgktmtekeivdyvasqvttakklrggvvfvdevpkgltgkldarkireilikakkggk
    skl