PDB entry 5kyo

View 5kyo on RCSB PDB site
Description: Crystal Structure of CYP101J2
Class: oxidoreductase
Keywords: cytochrome P450 monooxygenase, 1, 8-cineole hydroxylation, OXIDOREDUCTASE
Deposited on 2016-07-22, released 2017-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-26, with a file datestamp of 2017-04-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyp101j2
    Species: Sphingobium yanoikuyae [TaxId:13690]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KYO (Start-429)
    Domains in SCOPe 2.07: d5kyoa_
  • Chain 'B':
    Compound: cyp101j2
    Species: Sphingobium yanoikuyae [TaxId:13690]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KYO (Start-429)
    Domains in SCOPe 2.07: d5kyob_
  • Chain 'C':
    Compound: cyp101j2
    Species: Sphingobium yanoikuyae [TaxId:13690]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KYO (Start-429)
    Domains in SCOPe 2.07: d5kyoc_
  • Chain 'D':
    Compound: cyp101j2
    Species: Sphingobium yanoikuyae [TaxId:13690]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KYO (Start-429)
    Domains in SCOPe 2.07: d5kyod_
  • Chain 'E':
    Compound: cyp101j2
    Species: Sphingobium yanoikuyae [TaxId:13690]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KYO (Start-429)
    Domains in SCOPe 2.07: d5kyoe_
  • Chain 'F':
    Compound: cyp101j2
    Species: Sphingobium yanoikuyae [TaxId:13690]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KYO (Start-429)
    Domains in SCOPe 2.07: d5kyof_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kyoA (A:)
    mgsshhhhhhssglvprgshmeasvkgaagqmterpdnvpadrvfdfdiyrdvpegldfh
    qswreimrqaphplmwtphngghwvalrsdlaetvmsdferfsnhtvlvpketageayrl
    iplsldppehrpfrsllnenlgpkplrpieqvvtdlavsliegfrpkgrcnfthefaeql
    pvrifmrivdlpvedlpklkhladqytrpdgsiplddvtkqfreylrpviearrikpged
    misrmingevggrpltdieaeniciqvlvggldtvvnmlgftfshlakdhalrraiaadp
    sliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvvvamddarnedplef
    rlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefrieddaplrysngivgs
    vkpfvlewpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyoA (A:)
    mterpdnvpadrvfdfdiyrdvpegldfhqswreimrqaphplmwtphngghwvalrsdl
    aetvmsdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieq
    vvtdlavsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytipld
    dvtkqfreylrpviearrikpgedmisrmingevggrpltdieaeniciqvlvggldtvv
    nmlgftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllka
    gdmvmaptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrew
    faripefrieddaplrysngivgsvkpfvlewpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kyoB (B:)
    mgsshhhhhhssglvprgshmeasvkgaagqmterpdnvpadrvfdfdiyrdvpegldfh
    qswreimrqaphplmwtphngghwvalrsdlaetvmsdferfsnhtvlvpketageayrl
    iplsldppehrpfrsllnenlgpkplrpieqvvtdlavsliegfrpkgrcnfthefaeql
    pvrifmrivdlpvedlpklkhladqytrpdgsiplddvtkqfreylrpviearrikpged
    misrmingevggrpltdieaeniciqvlvggldtvvnmlgftfshlakdhalrraiaadp
    sliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvvvamddarnedplef
    rlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefrieddaplrysngivgs
    vkpfvlewpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyoB (B:)
    terpdnvpadrvfdfdiyrdvpegldfhqswreimrqphplmwtphngghwvalrsdlae
    tvmsdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvv
    tdlavsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytripldd
    vtkqfreylrpviearrikpgedmisrmingevggrpltdieaeniciqvlvggldtvvn
    mlgftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllkag
    dmvmaptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrewf
    aripefrieddaplrysngivgsvkpfvlewpv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kyoC (C:)
    mgsshhhhhhssglvprgshmeasvkgaagqmterpdnvpadrvfdfdiyrdvpegldfh
    qswreimrqaphplmwtphngghwvalrsdlaetvmsdferfsnhtvlvpketageayrl
    iplsldppehrpfrsllnenlgpkplrpieqvvtdlavsliegfrpkgrcnfthefaeql
    pvrifmrivdlpvedlpklkhladqytrpdgsiplddvtkqfreylrpviearrikpged
    misrmingevggrpltdieaeniciqvlvggldtvvnmlgftfshlakdhalrraiaadp
    sliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvvvamddarnedplef
    rlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefrieddaplrysngivgs
    vkpfvlewpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyoC (C:)
    terpdnvpadrvfdfdiyrdvpegldfhqswreimrqapplmwtphngghwvalrsdlae
    tvmsdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvv
    tdlavsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytlddvtk
    qfreylrpviearrikpgedmisrmingevggrpltdieaeniciqvlvggldtvvnmlg
    ftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllkagdmv
    maptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrewfari
    pefrieddaplrysngivgsvkpfvlewpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kyoD (D:)
    mgsshhhhhhssglvprgshmeasvkgaagqmterpdnvpadrvfdfdiyrdvpegldfh
    qswreimrqaphplmwtphngghwvalrsdlaetvmsdferfsnhtvlvpketageayrl
    iplsldppehrpfrsllnenlgpkplrpieqvvtdlavsliegfrpkgrcnfthefaeql
    pvrifmrivdlpvedlpklkhladqytrpdgsiplddvtkqfreylrpviearrikpged
    misrmingevggrpltdieaeniciqvlvggldtvvnmlgftfshlakdhalrraiaadp
    sliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvvvamddarnedplef
    rlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefrieddaplrysngivgs
    vkpfvlewpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyoD (D:)
    erpdnvpadrvfdfdiyrdvpgldfhqswreimrphplmwtphngghwvalrsdlaetvm
    sdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvvtdl
    avsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytrpdplddvt
    kqfreylrpviearrikpgedmisrminltdieaeniciqvlvggldtvvnmlgftfshl
    akdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvv
    vamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefrie
    ddaplrysngivgsvkpfvlewpv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5kyoE (E:)
    mgsshhhhhhssglvprgshmeasvkgaagqmterpdnvpadrvfdfdiyrdvpegldfh
    qswreimrqaphplmwtphngghwvalrsdlaetvmsdferfsnhtvlvpketageayrl
    iplsldppehrpfrsllnenlgpkplrpieqvvtdlavsliegfrpkgrcnfthefaeql
    pvrifmrivdlpvedlpklkhladqytrpdgsiplddvtkqfreylrpviearrikpged
    misrmingevggrpltdieaeniciqvlvggldtvvnmlgftfshlakdhalrraiaadp
    sliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvvvamddarnedplef
    rlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefrieddaplrysngivgs
    vkpfvlewpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyoE (E:)
    rpdnvpadrvfdfdiyrdvpldfhqswreimrqaphplmwtphngghwvalrsdlaetvm
    sdferfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvvtdl
    avsliegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytrpdgplddv
    tkqfreylrpviearrikpgedmisrmingevggltdieaeniciqvlvggldtvvnmlg
    ftfshlakdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllkagdmv
    maptvvvamddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrewfari
    pefrieddaplrysngivgsvkpfvlewpv
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5kyoF (F:)
    mgsshhhhhhssglvprgshmeasvkgaagqmterpdnvpadrvfdfdiyrdvpegldfh
    qswreimrqaphplmwtphngghwvalrsdlaetvmsdferfsnhtvlvpketageayrl
    iplsldppehrpfrsllnenlgpkplrpieqvvtdlavsliegfrpkgrcnfthefaeql
    pvrifmrivdlpvedlpklkhladqytrpdgsiplddvtkqfreylrpviearrikpged
    misrmingevggrpltdieaeniciqvlvggldtvvnmlgftfshlakdhalrraiaadp
    sliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvvvamddarnedplef
    rlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefrieddaplrysngivgs
    vkpfvlewpv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyoF (F:)
    erpdnvpadrvfdfdiyrdvpegldfhqswreplmwtphngghwvalrsdlaetvmsdfe
    rfsnhtvlvpketageayrliplsldppehrpfrsllnenlgpkplrpieqvvtdlavsl
    iegfrpkgrcnfthefaeqlpvrifmrivdlpvedlpklkhladqytplddvtkqfreyl
    rpviearrikpgedmisrmingevggpltdieaeniciqvlvggldtvvnmlgftfshla
    kdhalrraiaadpsliddalleffrrfpvvssarevlrdqefegvllkagdmvmaptvvv
    amddarnedplefrlgrkarqhstfgkgshtcpgahlarmemkvvlrewfaripefried
    daplrysngivgsvkpfvlewpv