PDB entry 5kya

View 5kya on RCSB PDB site
Description: Brain penetrant liver X receptor (LXR) modulators based on a 2,4,5,6-tetrahydropyrrolo[3,4-c]pyrazole core
Class: DNA binding protein
Keywords: Nuclear receptor, Liver X Receptor, LXRbeta-LBD/RXRbeta-LBD heterodimer, Chemical modulators, DNA BINDING PROTEIN
Deposited on 2016-07-21, released 2016-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55055
      • engineered mutation (67-68)
      • engineered mutation (70)
      • expression tag (275-283)
  • Chain 'B':
    Compound: Retinoic acid receptor RXR-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRB, NR2B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28702 (Start-236)
      • expression tag (242-251)
    Domains in SCOPe 2.06: d5kyab1, d5kyab2
  • Chain 'E':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55055
      • engineered mutation (65)
      • engineered mutation (67-68)
      • engineered mutation (70)
      • expression tag (275-283)
  • Chain 'F':
    Compound: Retinoic acid receptor RXR-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRB, NR2B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28702 (Start-236)
      • expression tag (241-251)
    Domains in SCOPe 2.06: d5kyaf1, d5kyaf2
  • Heterogens: 6Y4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kyaB (B:)
    hmgapeempvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlv
    ewakriphfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsa
    gvgaifdrvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasl
    etyckqkypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleagsg
    sgshkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyaB (B:)
    eempvdrileaelavepvtnicqaadkqlftlvewakriphfsslplddqvillragwne
    lliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktel
    gclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrs
    iglkclehlfffkligdtflmemleashkilhrllq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5kyaF (F:)
    hmgapeempvdrileaelaveqksdqgvegpggtggsgsspndpvtnicqaadkqlftlv
    ewakriphfsslplddqvillragwnelliasfshrsidvrdgillatglhvhrnsahsa
    gvgaifdrvltelvskmrdmrmdktelgclraiilfnpdakglsnpsevevlrekvyasl
    etyckqkypeqqgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleagsg
    sgshkilhrllqdsss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kyaF (F:)
    eempvdrileaelavepvtnicqaadkqlftlvewakriphfsslplddqvillragwne
    lliasfshrsidvrdgillatglhvhrnsahsagvgaifdrvltelvskmrdmrmdktel
    gclraiilfnpdakglsnpsevevlrekvyasletyckqkypeqqgrfaklllrlpalrs
    iglkclehlfffkligdtflmemleagshkilhrllq