PDB entry 5ky3

View 5ky3 on RCSB PDB site
Description: mouse POFUT1 in complex with mouse Factor VII EGF1 mutant (T101A) and GDP-fucose
Class: transferase
Keywords: glycosyltransferase, TRANSFERASE
Deposited on 2016-07-21, released 2017-05-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GDP-fucose protein O-fucosyltransferase 1
  Species: Mus musculus [TaxId:10090]
  Gene: Pofut1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q91ZW2 (3-354)
    • expression tag (1-2)
• Chain 'B':
  Compound: Coagulation factor VII
  Species: Mus musculus [TaxId:10090]
  Gene: F7, Cf7
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70375 (Start-39)
    • engineered mutation (14)
  Domains in SCOPe 2.08: d5ky3b_
• Heterogens: NAG, GOL, GFB, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >5ky3B (B:)
  dgdqcasnpcqnggacqdhlksyvcfclldfegrnceksk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5ky3B (B:)
  qcasnpcqnggacqdhlksyvcfclldfegrnceksk