PDB entry 5kwr

View 5kwr on RCSB PDB site
Description: Crystal structure of rat Cerebellin-1
Class: protein binding
Keywords: Synapse Protein, Extracellular Protein, Glycoprotein, Nervous System, PROTEIN BINDING
Deposited on 2016-07-18, released 2016-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cerebellin-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: CBLN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63182 (0-136)
      • expression tag (137-138)
    Domains in SCOPe 2.06: d5kwra1, d5kwra2
  • Heterogens: NAG, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kwrA (A:)
    sgsakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnf
    hvvkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnl
    mggwkystfsgflvfplhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kwrA (A:)
    sgsakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnf
    hvvkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnl
    mggwkystfsgflvfplhh