PDB entry 5kwq

View 5kwq on RCSB PDB site
Description: Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60
Class: splicing
Keywords: Tandem RRMs, c-Myc Regulation, Splicing Factor, SPLICING
Deposited on 2016-07-18, released 2017-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(U)-binding-splicing factor PUF60
    Species: Homo sapiens [TaxId:9606]
    Gene: PUF60, FIR, ROBPI, SIAHBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHX1 (17-End)
      • expression tag (15-16)
      • engineered mutation (22)
      • engineered mutation (28)
      • engineered mutation (154)
    Domains in SCOPe 2.07: d5kwqa1, d5kwqa2, d5kwqa3
  • Chain 'B':
    Compound: Poly(U)-binding-splicing factor PUF60
    Species: Homo sapiens [TaxId:9606]
    Gene: PUF60, FIR, ROBPI, SIAHBP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UHX1 (17-End)
      • expression tag (15-16)
      • engineered mutation (22)
      • engineered mutation (28)
      • engineered mutation (154)
    Domains in SCOPe 2.07: d5kwqb1, d5kwqb2, d5kwqb3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kwqA (A:)
    gshmasmtggqqmgrgsaaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidm
    swdsvtmkhkgfafveyevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlae
    earafnriyvasvhqdlsdddiksvfeafgkiksatlardpttgkhkgygfieyekaqss
    qdavssmnlfdlggqylrvgkavtppmplltpatpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kwqA (A:)
    gsaaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidmswvtmkhkgfafvey
    evpeaaqlaleqmnsvmlnikvgrpsnigqaqpiidqlaeearafnriyvasvhqdlsdd
    diksvfeafgkiksatlardpttgkhkgygfieyekaqssqdavssmnlfdlgqylrvgk
    avtppmpllt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kwqB (B:)
    gshmasmtggqqmgrgsaaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidm
    swdsvtmkhkgfafveyevpeaaqlaleqmnsvmlggrnikvgrpsnigqaqpiidqlae
    earafnriyvasvhqdlsdddiksvfeafgkiksatlardpttgkhkgygfieyekaqss
    qdavssmnlfdlggqylrvgkavtppmplltpatpg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kwqB (B:)
    gsaaqrqgalaimsrvyvgsiyyelgedtirqafapfgpiksidmswvtmkhkgfafvey
    evpeaaqlaleqmnsvmlnikvgrpsnigqaqpiidqlaeearafnriyvasvhqdlsdd
    diksvfeafgkiksatlardpttgkhkgygfieyekaqssqdavssmnlfdlgqylrvgk
    avtppmplltp