PDB entry 5kvg

View 5kvg on RCSB PDB site
Description: Zika specific antibody, ZV-67, bound to ZIKA envelope DIII
Class: viral protein/immune system
Keywords: Zika virus, envelope protein, viral protein, antibody, structural genomics, CSGID, Center for Structural Genomics of Infectious Diseases, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2016-07-14, released 2016-08-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: ZIKA Envelope DIII
    Species: Zika virus [TaxId:64320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A024B7W1 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d5kvge_
  • Chain 'H':
    Compound: ZV-67 Antibody Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KVG (0-218)
  • Chain 'L':
    Compound: ZV-67 Antibody Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KVG (0-213)
    Domains in SCOPe 2.06: d5kvgl1, d5kvgl2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download) 
    >5kvgE (E:)
mrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgr
litanpvitestenskmmleldppfgdsyivigvgekkithhwhrsgsti

    Sequence, based on observed residues (ATOM records): (download) 
    >5kvgE (E:)
mrlkgvsyslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgr
litanpvitestenskmmleldppfgdsyivigvgekkithhwhrsg

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5kvgL (L:)
divmtqsqkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
rftgsgsgtdftltisnmqsedladyfcqqfssypytfgggtkleikradaaptvsifpp
sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
ltkdeyerhnsytceathktstspivksfnrnec