PDB entry 5kun

View 5kun on RCSB PDB site
Description: Human cyclophilin A at 100K, Data set 2
Class: isomerase
Keywords: Conformational variation, Radiation damage, ISOMERASE
Deposited on 2016-07-13, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIA, CYPA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kuna_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kunA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle