PDB entry 5ktq

View 5ktq on RCSB PDB site
Description: large fragment of taq dna polymerase bound to dctp
Deposited on 1998-09-22, released 1998-09-30
The last revision prior to the SCOP 1.59 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ktqA (A:)
    spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
    gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
    erlfanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiar
    leaevfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpiv
    ekilqyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtp
    lgqrirrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgv
    preavdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiek
    tleegrrrgyvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklf
    prleemgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwls
    ake
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ktqA (A:)
    spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
    gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
    erlfanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiar
    leaevfrlaghpfnlnsrdqlervlfdelglpaistsaavlealreahpivekilqyrel
    tklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirraf
    iaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplm
    rraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrg
    yvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgar
    mllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake