PDB entry 5ksv

View 5ksv on RCSB PDB site
Description: Crystal structure of HLA-DQ2.5-CLIP2
Class: immune system
Keywords: hla-dq2.5, clip2, immune system
Deposited on 2016-07-10, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II HLA-DQ-alpha chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ksva1, d5ksva2
  • Chain 'B':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ksvb1, d5ksvb2
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSV (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ksvA (A:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epeipapmseltevdiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksvA (A:)
    ivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfal
    tniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvnit
    wlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ksvB (B:)
    rdspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaey
    wnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvt
    dfypaqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpsl
    qspitvewraqsesaqskvdiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksvB (B:)
    spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
    sqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsnllvcsvtdfypaqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewra
    

  • Chain 'C':
    No sequence available.