PDB entry 5ksu

View 5ksu on RCSB PDB site
Description: Crystal structure of HLA-DQ2.5-CLIP1 at 2.73 resolution
Class: immune system
Keywords: HLA, MHC, DQ2.5, CLIP, celiac disease, IMMUNE SYSTEM
Deposited on 2016-07-10, released 2017-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ksua1, d5ksua2
  • Chain 'B':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ksub1, d5ksub2
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSU (0-End)
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ksud1, d5ksud2
  • Chain 'E':
    Compound: MHC class II HLA-DQ-beta-1
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ksue1, d5ksue2
  • Chain 'F':
    Compound: HLA class II histocompatibility antigen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSU (0-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ksuA (A:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epeipapmseltevdiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksuA (A:)
    divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfa
    ltniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwe
    pe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ksuB (B:)
    rdspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaey
    wnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvt
    dfypaqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpsl
    qspitvewraqsesaqskvdiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksuB (B:)
    spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
    sqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsnllvcsvtdfypaqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ksuD (D:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epeipapmseltevdiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksuD (D:)
    divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwclpvlrqfrfdpqfa
    ltniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwe
    pe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ksuE (E:)
    rdspedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaey
    wnsqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsrtealnhhnllvcsvt
    dfypaqikvrwfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpsl
    qspitvewraqsesaqskvdiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksuE (E:)
    spedfvyqfkgmcyftngtervrlvsrsiynreeivrfdsdvgefravtllglpaaeywn
    sqkdilerkraavdrvcrhnyqlelrttlqrrveptvtispsnllvcsvtdfypaqikvr
    wfrndqeetagvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqspitvewr
    

  • Chain 'F':
    No sequence available.