PDB entry 5ksb

View 5ksb on RCSB PDB site
Description: T15-DQ8.5-glia-gamma1 complex
Class: immune system
Keywords: Celiac Disease T cell receptor peptide MHC complex, IMMUNE SYSTEM
Deposited on 2016-07-08, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01909
      • conflict (46)
    Domains in SCOPe 2.07: d5ksba1, d5ksba2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ksbb1, d5ksbb2
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01909
      • conflict (46)
    Domains in SCOPe 2.07: d5ksbc1, d5ksbc2
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ksbd1, d5ksbd2
  • Chain 'E':
    Compound: T15 TCR alpha TRAV20*02
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSB
    Domains in SCOPe 2.07: d5ksbe1, d5ksbe2
  • Chain 'F':
    Compound: T15 TCR beta TRBV9*01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSB
    Domains in SCOPe 2.07: d5ksbf1, d5ksbf2
  • Chain 'G':
    Compound: T15 TCR alpha TRAV20*02
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSB
    Domains in SCOPe 2.07: d5ksbg1, d5ksbg2
  • Chain 'H':
    Compound: T15 TCR beta TRBV9*01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSB
    Domains in SCOPe 2.07: d5ksbh1, d5ksbh2
  • Chain 'I':
    Compound: DQ8.5-glia-gamma1 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSB (0-10)
  • Chain 'J':
    Compound: DQ8.5-glia-gamma1 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KSB (0-10)
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ksbA (A:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksbA (A:)
    divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfa
    ltniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwe
    p
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ksbB (B:)
    qpqqsfpeqegsggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtryiynre
    eyarfdsdvgvyravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrv
    eptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtf
    qilvmlemtpqrgdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksbB (B:)
    dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
    nsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispllvcsvtdfypaqikvrw
    frndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnpiivewra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ksbC (C:)
    edivadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqf
    altniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhw
    epetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksbC (C:)
    divadhvasygvnlyqsygpsgqythefdgdeqfyvdlgrketvwslpvlrqfrfdpqfa
    ltniavlkhnlnslikrsnstaatnevpevtvfskspvtlgqpniliclvdnifppvvni
    twlsnghsvtegvsetsflsksdhsffkisyltllpsaeesydckvehwgldkpllkhwe
    p
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ksbD (D:)
    qpqqsfpeqegsggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtryiynre
    eyarfdsdvgvyravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrttlqrrv
    eptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirngdwtf
    qilvmlemtpqrgdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksbD (D:)
    dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
    nsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispllvcsvtdfypaqikvrw
    frndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnpiivewr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ksbE (E:)
    medqvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekek
    erlkatltkkesflhitapkpedsatylcavqasggsyiptfgrgtslivhpyiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksbE (E:)
    dqvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekeker
    lkatltkkesflhitapkpedsatylcavqasggsyiptfgrgtslivhpyiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffps
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ksbF (F:)
    mgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnil
    erfsaqqfpdlhselnlsslelgdsalyfcassnrglgtdtqyfgpgtrltvledlknvf
    ppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksbF (F:)
    gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile
    rfsaqqfpdlhselnlsslelgdsalyfcassnrglgtdtqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    a
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ksbG (G:)
    medqvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekek
    erlkatltkkesflhitapkpedsatylcavqasggsyiptfgrgtslivhpyiqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksbG (G:)
    dqvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekeker
    lkatltkkesflhitapkpedsatylcavqasggsyiptfgrgtslivhpyiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiipedtffps
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ksbH (H:)
    mgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnil
    erfsaqqfpdlhselnlsslelgdsalyfcassnrglgtdtqyfgpgtrltvledlknvf
    ppevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ksbH (H:)
    gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile
    rfsaqqfpdlhselnlsslelgdsalyfcassnrglgtdtqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    a
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.