PDB entry 5ks9

View 5ks9 on RCSB PDB site
Description: Bel502-DQ8-glia-alpha1 complex
Class: immune system
Keywords: Celiac Disease T cell receptor peptide MHC complex, IMMUNE SYSTEM
Deposited on 2016-07-08, released 2016-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ks9a1, d5ks9a2
  • Chain 'B':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed):
    • PDB 5KS9
    • Uniprot U3PYM0 (Start-221)
    Domains in SCOPe 2.07: d5ks9b1, d5ks9b2
  • Chain 'C':
    Compound: HLA class II histocompatibility antigen, DQ alpha 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ks9c1, d5ks9c2
  • Chain 'D':
    Compound: HLA class II histocompatibility antigen, DQ beta 1 chain
    Species: Homo sapiens [TaxId:9606]
    Gene: HLA-DQB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ks9d1, d5ks9d2
  • Chain 'E':
    Compound: Bel502 TCR alpha TRAV20*01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KS9
    Domains in SCOPe 2.07: d5ks9e1, d5ks9e2
  • Chain 'F':
    Compound: Bel502 TCR beta TRBV9*01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KS9
    Domains in SCOPe 2.07: d5ks9f1, d5ks9f2
  • Chain 'G':
    Compound: Bel502 TCR alpha TRAV20*01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KS9
    Domains in SCOPe 2.07: d5ks9g1, d5ks9g2
  • Chain 'H':
    Compound: Bel502 TCR beta TRBV9*01
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KS9
    Domains in SCOPe 2.07: d5ks9h1, d5ks9h2
  • Chain 'I':
    Compound: DQ8-glia-alpha1 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KS9 (0-15)
  • Chain 'J':
    Compound: DQ8-glia-alpha1 peptide
    Species: Triticum aestivum [TaxId:4565]
    Database cross-references and differences (RAF-indexed):
    • PDB 5KS9 (0-15)
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ks9A (A:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkh
    wepetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ks9A (A:)
    divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
    altniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhw
    ep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ks9B (B:)
    psgegsfqpsqenpqgsggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtry
    iynreeyarfdsdvgvyravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrtt
    lqrrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirn
    gdwtfqilvmlemtpqrgdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ks9B (B:)
    dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
    nsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispllvcsvtdfypaqikvrw
    frndqeettgvvstplirngdwtfqilvmlemtpqrgdvytchvehpslqnpiivewraq
    s
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ks9C (C:)
    edivadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpq
    faltniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvv
    nitwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkh
    wepetsgddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ks9C (C:)
    divadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqf
    altniavlkhnlnivikrsnstaatnevpevtvfskspvtlgqpntliclvdnifppvvn
    itwlsnghsvtegvsetsflsksdhsffkisyltflpsadeiydckvehwgldepllkhw
    ep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ks9D (D:)
    psgegsfqpsqenpqgsggsiegrggsgasrdspedfvyqfkgmcyftngtervrlvtry
    iynreeyarfdsdvgvyravtplgppaaeywnsqkevlertraeldtvcrhnyqlelrtt
    lqrrveptvtispsrtealnhhnllvcsvtdfypaqikvrwfrndqeettgvvstplirn
    gdwtfqilvmlemtpqrgdvytchvehpslqnpiivewraqstggddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ks9D (D:)
    dspedfvyqfkgmcyftngtervrlvtryiynreeyarfdsdvgvyravtplgppaaeyw
    nsqkevlertraeldtvcrhnyqlelrttlqrrveptvtispllvcsvtdfypaqikvrw
    frndqeettgvvstplirngdwtfqilvmlemdvytchvehpslqnpiivewr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ks9E (E:)
    medqvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekek
    erlkatltkkesflhitapkpedsatylcavalnnnagnmltfgggtrlmvkphiqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ks9E (E:)
    qvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekekerl
    katltkkesflhitapkpedsatylcavalnnnagnmltfgggtrlmvkphiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsiip
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5ks9F (F:)
    mgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnil
    erfsaqqfpdlhselnlsslelgdsalyfcassvapgsdtqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ks9F (F:)
    gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile
    rfsaqqfpdlhselnlsslelgdsalyfcassvapgsdtqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5ks9G (G:)
    medqvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekek
    erlkatltkkesflhitapkpedsatylcavalnnnagnmltfgggtrlmvkphiqnpdp
    avyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
    ksdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ks9G (G:)
    qvtqspealrlqegessslncsytvsglrglfwyrqdpgkgpeflftlysageekekerl
    katltkkesflhitapkpedsatylcavalnnnagnmltfgggtrlmvkphiqnpdpavy
    qlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksd
    facanafnnsii
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5ks9H (H:)
    mgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnil
    erfsaqqfpdlhselnlsslelgdsalyfcassvapgsdtqyfgpgtrltvledlknvfp
    pevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    ad
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ks9H (H:)
    gvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnile
    rfsaqqfpdlhselnlsslelgdsalyfcassvapgsdtqyfgpgtrltvledlknvfpp
    evavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpal
    ndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgra
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.