PDB entry 5kre

View 5kre on RCSB PDB site
Description: Covalent inhibitor of LYPLAL1
Class: HYDROLASE/HYDROLASE inhibitor
Keywords: LYPLAL1, serine hydrolase, covalent inhibitor, HYDROLASE-HYDROLASE inhibitor complex
Deposited on 2016-07-07, released 2016-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysophospholipase-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: LYPLAL1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5VWZ2
      • variant (132)
    Domains in SCOPe 2.06: d5krea_
  • Heterogens: 6WG, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kreA (A:)
    gpmaaasgsvlqrcivspagrhsasliflhgsgdsgqglrmwikqvlnqdltfqhikiiy
    ptapprsytpmkggisnvwfdrfkitndcpehlesidvmcqvltdlideevksgikknri
    liggfsmggcmamhlayrnhqdvagvfalssflnkasavyqalqksngvlpelfqchgta
    delvlhswaeetnsmlkslgvttkfhsfpnvyhelskteldilklwiltklpgemekqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kreA (A:)
    vlqrcivspagrhsasliflhgsgdsgqglrmwikqvlnqdltfqhikiiyptapprsyt
    pmkggisnvwfdrfkitndcpehlesidvmcqvltdlideevksgikknriliggfsmgg
    cmamhlayrnhqdvagvfalssflnkasavyqalqksngvlpelfqchgtadelvlhswa
    eetnsmlkslgvttkfhsfpnvyhelskteldilklwiltklpg