PDB entry 5kr2

View 5kr2 on RCSB PDB site
Description: Protease PR5-SQV
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, E35D, salt-bridge interaction, Natural polymorphism, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2016-07-06, released 2016-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease PR5-SQV
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5YAB1 (0-98)
      • conflict (6)
      • conflict (24)
      • conflict (32)
      • conflict (56)
      • conflict (62)
      • conflict (66)
      • conflict (94)
  • Chain 'B':
    Compound: Protease PR5-SQV
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5YAB1 (0-98)
      • conflict (6)
      • conflict (24)
      • conflict (32)
      • conflict (56)
      • conflict (62)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.06: d5kr2b_
  • Chain 'C':
    Compound: Protease PR5-SQV
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5YAB1 (0-98)
      • conflict (6)
      • conflict (24)
      • conflict (32)
      • conflict (56)
      • conflict (62)
      • conflict (66)
      • conflict (94)
  • Chain 'D':
    Compound: Protease PR5-SQV
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot V5YAB1 (0-98)
      • conflict (6)
      • conflict (24)
      • conflict (32)
      • conflict (56)
      • conflict (62)
      • conflict (66)
      • conflict (94)
  • Heterogens: ROC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5kr2B (B:)
    pqitlwkrplvtikvggqlkeallntgaddtviedmnlpgkwkpkmiggiggfikvkqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.