PDB entry 5kpo

View 5kpo on RCSB PDB site
Description: Structure of human PARP1 catalytic domain bound to a quinazoline-2,4(1H,3H)-dione inhibitor
Class: transferase/transferase inhibitor
Keywords: Inhibitor, Complex, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2016-07-05, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-351)
      • expression tag (0-1)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d5kpoa1, d5kpoa2, d5kpoa3
  • Chain 'B':
    Compound: Poly [ADP-ribose] polymerase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP1, ADPRT, PPOL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09874 (2-351)
      • expression tag (0-1)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d5kpob1, d5kpob2, d5kpob3
  • Heterogens: 6WY

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kpoA (A:)
    hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
    ggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifki
    eregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfad
    mvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdps
    anisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kpoA (A:)
    hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgsdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrg
    gsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkie
    regecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadm
    vsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsa
    nisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kpoB (B:)
    hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllr
    ggsddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifki
    eregecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfad
    mvsksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdps
    anisldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kpoB (B:)
    hmksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqa
    vsqgsdsqildlsnrfytliphdfgmkppllnnadsvqakaemldnlldievaysllrgg
    sddsskdpidvnyeklktdikvvdrdseeaeiirkyvknthatthnaydlevidifkier
    egecqrykpfkqlhnrrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmv
    sksanychtsqgdpiglillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsan
    isldgvdvplgtgissgvndtsllyneyivydiaqvnlkyllklkfnfkt