PDB entry 5ko6

View 5ko6 on RCSB PDB site
Description: Crystal Structure of Isoform 2 of Purine Nucleoside Phosphorylase from Schistosoma mansoni in complex with cytosine and ribose-1-phosphate
Class: transferase
Keywords: transferase
Deposited on 2016-06-29, released 2017-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Schistosoma mansoni [TaxId:6183]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ko6a_
  • Heterogens: CYT, R1P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ko6A (A:)
    mttpvvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpk
    ttvaghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlag
    ginrklksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkia
    qendfqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlav
    sliannsildaendvsinhekvlavaekradllqmwfkeiitrlpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ko6A (A:)
    tpvvanyenasmaadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpktt
    vaghvgnlvlgsvggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlaggi
    nrklksgdfvlikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkiaqe
    ndfqdlvhegvyafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlavsl
    iannsildaendvsinhekvlavaekradllqmwfkeiitrlpld