PDB entry 5km6

View 5km6 on RCSB PDB site
Description: Human Histidine Triad Nucleotide Binding Protein 1 (hHint1) H112N mutant Ara-A nucleoside phosphoramidate substrate complex
Class: hydrolase
Keywords: HINT, histidine triad, HIT, HYDROLASE
Deposited on 2016-06-26, released 2017-06-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine triad nucleotide-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HINT1, HINT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49773 (Start-128)
      • engineered mutation (114)
    Domains in SCOPe 2.08: d5km6a_
  • Heterogens: 6US, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5km6A (A:)
    snamadeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipk
    khisqisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvnlhvlg
    grqmhwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5km6A (A:)
    dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg
    hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvnlhvlggrqmhwppg