PDB entry 5kkc

View 5kkc on RCSB PDB site
Description: l-lactate dehydrogenase from rabbit muscle with the inhibitor 6DHNAD
Class: oxidoreductase
Keywords: lactate dehydrogenase, inhibitor, 6DHNAD, beta- 6-dihydronicotimide adenine dinucleotide, oxidoreductase
Deposited on 2016-06-21, released 2016-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13491 (0-330)
      • conflict (247)
      • conflict (275)
    Domains in SCOPe 2.07: d5kkca1, d5kkca2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13491 (Start-330)
      • conflict (247)
      • conflict (275)
    Domains in SCOPe 2.07: d5kkcb1, d5kkcb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13491
      • conflict (247)
      • conflict (275)
    Domains in SCOPe 2.07: d5kkcc1, d5kkcc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13491 (0-End)
      • conflict (247)
      • conflict (275)
    Domains in SCOPe 2.07: d5kkcd1, d5kkcd2
  • Heterogens: 6V0, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kkcA (A:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kkcA (A:)
    aalkdqlihnllkvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkgemmd
    lqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
    vkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhals
    chgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayevikl
    kgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcvlgqngisdvv
    kvtltseeeahlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kkcB (B:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kkcB (B:)
    alkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkgem
    mdlqhgslflrtpkivsgkdysvtansklviitagarvqrnvnifkfiipnvvkysphck
    llvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhalschgwilge
    hgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayeviklkgytswai
    glsvadlaesimknlrrvhpistmikglygikedvflsvpcvlgqngisdvvkvtltsee
    eahlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kkcC (C:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kkcC (C:)
    alkdqlihnllkhvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkgemmd
    lqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfiipnv
    vkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhals
    chgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayevikl
    kgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcvlgqngisdvv
    kvtltseeeahlkksadtlwgiqkel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kkcD (D:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kkcD (D:)
    aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
    mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkysphckllvvsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    alschgwilgehgdssvpvwsgmnvagvslktlhpelgtdadkeqwkqvhkqvvdsayev
    iklkgytswaiglsvadlaesimknlrrvhpistmikglygikedvflsvpcvlgqngis
    dvvkvtltseeeahlkksadtlwgiqkel