PDB entry 5kjy

View 5kjy on RCSB PDB site
Description: Co-crystal structure of PKG RI alpha CNB-B mutant (G316R/A336T) with cAMP
Class: signaling protein
Keywords: Cyclic nucleotide, cAMP-dependent protein kinase, nucleotide selectivity, cyclic nucleotide binding domain, SIGNALING PROTEIN
Deposited on 2016-06-20, released 2017-06-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type I-alpha regulatory subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKAR1A, PKR1, PRKAR1, TSE1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10644
      • engineered mutation (84)
      • engineered mutation (104)
    Domains in SCOPe 2.06: d5kjya_
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kjyA (A:)
    gsilmgstlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgde
    ffiilegsaavlqrrseneefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkld
    rprfervlgpcsdilkrniqqynsfvslsv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kjyA (A:)
    stlrkrkmyeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiile
    gsaavlqrrseefvevrrlgpsdyfgeiallmnrprtatvvargplkcvkldrprfervl
    gpcsdilkrniqqynsfvsl