PDB entry 5kho

View 5kho on RCSB PDB site
Description: Rasip1 RA domain in complex with Rap1B
Class: signaling protein
Keywords: Rasip1, Ras-Association domain, Rap1B, complex, SIGNALING PROTEIN
Deposited on 2016-06-15, released 2016-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASIP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ras-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RASIP1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5khoc_
  • Chain 'D':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B, OK/SW-cl.11
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5khod_
  • Heterogens: GOL, MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5khoC (C:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5khoC (C:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    tftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdled
    ervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5khoD (D:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr