PDB entry 5kf0

View 5kf0 on RCSB PDB site
Description: Crystal structure of an Aldedhyde dehydrogenase from Burkholderia vietnamiensis
Class: oxidoreductase
Keywords: SSGCID, Aldehyde dehydrogenase, Burkholderia thailandensis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2016-06-10, released 2016-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_4170
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4JLJ7 (8-484)
      • expression tag (5-7)
    Domains in SCOPe 2.07: d5kf0a1, d5kf0a2
  • Chain 'B':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_4170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kf0b_
  • Chain 'C':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_4170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kf0c_
  • Chain 'D':
    Compound: aldehyde dehydrogenase
    Species: Burkholderia vietnamiensis (strain G4 / LMG 22486) [TaxId:269482]
    Gene: Bcep1808_4170
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kf0d_
  • Heterogens: NDP, MG, MRD, ACT, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kf0A (A:)
    mahhhhhhmlkdtypyylaneavyantdlevtdkfsgkvatrvaladaqaidaaigaavd
    avkpmrelpayrrqavldhcvarfrerfdelaealcieagkpindsrgevtrlidtfrva
    seeavridgevlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpvgaliiaevlaetnlpkgafsvlpahrdgadlfttderfrllsftgspa
    vgwalkekagkkkvvlelggnaaaivdadqfeqldyvvdrlafgayyqsgqscigvqril
    vhaslydtlrdklvaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiia
    ggkvdgamfeatlledvgreqdlyrkeafgpvailekfdrfddalarvndsdfglqagvf
    tdslthaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprlm
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kf0A (A:)
    hhhmlkdtypyylaneavyantdlevtdkfsgkvatrvaladaqaidaaigaavdavkpm
    relpayrrqavldhcvarfrerfdelaealcieagkpindsrgevtrlidtfrvaseeav
    ridgevlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagcpfvlk
    pasrtpvgaliiaevlaetnlpkgafsvlpahrdgadlfttderfrllsftgspavgwal
    kekagkkkvvlelggnaaaivdadqfeqldyvvdrlafgayyqsgqscigvqrilvhasl
    ydtlrdklvaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiiaggkvd
    gamfeatlledvgreqdlyrkeafgpvailekfdrfddalarvndsdfglqagvftdslt
    haqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprlmvvrrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kf0B (B:)
    mahhhhhhmlkdtypyylaneavyantdlevtdkfsgkvatrvaladaqaidaaigaavd
    avkpmrelpayrrqavldhcvarfrerfdelaealcieagkpindsrgevtrlidtfrva
    seeavridgevlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpvgaliiaevlaetnlpkgafsvlpahrdgadlfttderfrllsftgspa
    vgwalkekagkkkvvlelggnaaaivdadqfeqldyvvdrlafgayyqsgqscigvqril
    vhaslydtlrdklvaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiia
    ggkvdgamfeatlledvgreqdlyrkeafgpvailekfdrfddalarvndsdfglqagvf
    tdslthaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprlm
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kf0B (B:)
    lkdtypyylaneavyantdlevtdkfsgkvatrvaladaqaidaaigaavdavkpmrelp
    ayrrqavldhcvarfrerfdelaealcieagkpindsrgevtrlidtfrvaseeavridg
    evlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpasr
    tpvgaliiaevlaetnlpkgafsvlpahrdgadlfttderfrllsftgspavgwalkeka
    gkkkvvlelggnaaaivdadqfeqldyvvdrlafgayyqsgqscigvqrilvhaslydtl
    rdklvaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiiaggkvdgamf
    eatlledvgreqdlyrkeafgpvailekfdrfddalarvndsdfglqagvftdslthaqr
    awdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprlmvvrrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kf0C (C:)
    mahhhhhhmlkdtypyylaneavyantdlevtdkfsgkvatrvaladaqaidaaigaavd
    avkpmrelpayrrqavldhcvarfrerfdelaealcieagkpindsrgevtrlidtfrva
    seeavridgevlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpvgaliiaevlaetnlpkgafsvlpahrdgadlfttderfrllsftgspa
    vgwalkekagkkkvvlelggnaaaivdadqfeqldyvvdrlafgayyqsgqscigvqril
    vhaslydtlrdklvaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiia
    ggkvdgamfeatlledvgreqdlyrkeafgpvailekfdrfddalarvndsdfglqagvf
    tdslthaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprlm
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kf0C (C:)
    lkdtypyylaneavyantdlevtdkfsgkvatrvaladaqaidaaigaavdavkpmrelp
    ayrrqavldhcvarfrerfdelaealcieagkpindsrgevtrlidtfrvaseeavridg
    evlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpasr
    tpvgaliiaevlaetnlpkgafsvlpahrdgadlfttderfrllsftgspavgwalkeka
    gkkkvvlelggnaaaivdadqfeqldyvvdrlafgayyqsgqscigvqrilvhaslydtl
    rdklvaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiiaggkvdgamf
    eatlledvgreqdlyrkeafgpvailekfdrfddalarvndsdfglqagvftdslthaqr
    awdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprlmvvrrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kf0D (D:)
    mahhhhhhmlkdtypyylaneavyantdlevtdkfsgkvatrvaladaqaidaaigaavd
    avkpmrelpayrrqavldhcvarfrerfdelaealcieagkpindsrgevtrlidtfrva
    seeavridgevlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagc
    pfvlkpasrtpvgaliiaevlaetnlpkgafsvlpahrdgadlfttderfrllsftgspa
    vgwalkekagkkkvvlelggnaaaivdadqfeqldyvvdrlafgayyqsgqscigvqril
    vhaslydtlrdklvaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiia
    ggkvdgamfeatlledvgreqdlyrkeafgpvailekfdrfddalarvndsdfglqagvf
    tdslthaqrawdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprlm
    vvrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kf0D (D:)
    lkdtypyylaneavyantdlevtdkfsgkvatrvaladaqaidaaigaavdavkpmrelp
    ayrrqavldhcvarfrerfdelaealcieagkpindsrgevtrlidtfrvaseeavridg
    evlnleisaraqgytgytrrvpigpcsfispfnfplnlaahkvapalaagcpfvlkpasr
    tpvgaliiaevlaetnlpkgafsvlpahrdgadlfttderfrllsftgspavgwalkeka
    gkkkvvlelggnaaaivdadqfeqldyvvdrlafgayyqsgqscigvqrilvhaslydtl
    rdklvaktrslkmgdpkdpstfvgpmisesesrrlsgwmdaavaagakiiaggkvdgamf
    eatlledvgreqdlyrkeafgpvailekfdrfddalarvndsdfglqagvftdslthaqr
    awdelevggvvindvpsfrvdnmpyggvkdsglgregiryaiedmteprlmvvrrr