PDB entry 5kd1

View 5kd1 on RCSB PDB site
Description: Sperm whale myoglobin H64A with nitrosoamphetamine
Class: oxygen transport
Keywords: heme, myoglobin, nitrosoalkane, nitrosoamphetamine, 2-nitroso-1-phenylpropane, N-hydroxyamphetamine, C-nitroso, OXYGEN TRANSPORT
Deposited on 2016-06-07, released 2017-05-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (63)
      • engineered mutation (121)
    Domains in SCOPe 2.06: d5kd1a_
  • Heterogens: HEM, SO4, 3QM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5kd1A (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgyqg