PDB entry 5kc6

View 5kc6 on RCSB PDB site
Description: crystal structure of cbln1 (val55-gly58 deletion mutant)
Class: signaling protein
Keywords: Cerebellin, neurotransmission, Signaling protein
Deposited on 2016-06-05, released 2016-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cerebellin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23435 (Start-168)
      • expression tag (169-170)
    Domains in SCOPe 2.06: d5kc6a1, d5kc6a2
  • Chain 'B':
    Compound: Cerebellin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23435 (Start-168)
      • expression tag (169-177)
    Domains in SCOPe 2.06: d5kc6b1, d5kc6b2
  • Chain 'C':
    Compound: Cerebellin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23435 (Start-168)
      • expression tag (169)
    Domains in SCOPe 2.06: d5kc6c1, d5kc6c2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kc6A (A:)
    etgetepivlegkclvvcdsnptsdptgtalgissakvafsairstnhepsemsnrtmii
    yfdqvlvnignnfdserstfiaprkgiysfnfhvvkvynrqtiqvslmlngwpvisafag
    dqdvtreaasngvliqmekgdraylklergnlmggwkystfsgflvfplgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kc6A (A:)
    sakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhv
    vkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmg
    gwkystfsgflvfplgt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kc6B (B:)
    etgetepivlegkclvvcdsnptsdptgtalgissakvafsairstnhepsemsnrtmii
    yfdqvlvnignnfdserstfiaprkgiysfnfhvvkvynrqtiqvslmlngwpvisafag
    dqdvtreaasngvliqmekgdraylklergnlmggwkystfsgflvfplgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kc6B (B:)
    sakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhv
    vkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmg
    gwkystfsgflvfplgtkhhhhhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kc6C (C:)
    etgetepivlegkclvvcdsnptsdptgtalgissakvafsairstnhepsemsnrtmii
    yfdqvlvnignnfdserstfiaprkgiysfnfhvvkvynrqtiqvslmlngwpvisafag
    dqdvtreaasngvliqmekgdraylklergnlmggwkystfsgflvfplgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kc6C (C:)
    sakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfhv
    vkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlmg
    gwkystfsgflvfplg