PDB entry 5kc5

View 5kc5 on RCSB PDB site
Description: Crystal structure of the Cbln1 C1q domain trimer
Class: signaling protein
Keywords: Cerebellin, C1q, neurotransmission, Signaling protein
Deposited on 2016-06-05, released 2016-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cerebellin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBLN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23435 (2-137)
      • expression tag (138)
    Domains in SCOPe 2.06: d5kc5a1, d5kc5a2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kc5A (A:)
    etgsakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfn
    fhvvkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergn
    lmggwkystfsgflvfplgtkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kc5A (A:)
    gsakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnfh
    vvkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnlm
    ggwkystfsgflvfplg