PDB entry 5kby

View 5kby on RCSB PDB site
Description: Crystal structure of dipeptidyl peptidase IV in complex with SYR-472
Class: hydrolase/hydrolase inhibitor
Keywords: peptidase, glp-1, metabolic disease, co-complex, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2016-06-03, released 2016-07-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kbya1, d5kbya2
  • Chain 'B':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27487 (12-739)
      • expression tag (7-11)
    Domains in SCOPe 2.06: d5kbyb1, d5kbyb2, d5kbyb3
  • Chain 'C':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kbyc1, d5kbyc2
  • Chain 'D':
    Compound: dipeptidyl peptidase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: DPP4, ADCP2, CD26
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kbyd1, d5kbyd2
  • Heterogens: NAG, 6RL, 5AX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kbyA (A:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbyA (A:)
    rktytltdylkntyrlklyslrwisdheylykqnilvfnaeygnssvflenstfdefghs
    indysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvg
    hklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngt
    flayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtn
    atsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclv
    arqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgt
    wevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsf
    skeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilne
    tkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgr
    gsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlg
    sgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyl
    lihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikq
    cfslp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kbyB (B:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbyB (B:)
    hhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflens
    tfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntq
    wvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysa
    lwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvnt
    dslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydes
    sgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkd
    ctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnper
    cqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskk
    ldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteni
    ivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsygg
    yvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsrae
    nfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiyt
    hmshfikqcfslp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5kbyC (C:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbyC (C:)
    rktytltdylkntyrlklyslrwisdheylyilvfnaeyvflentfdefghsindysisp
    dgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvghklayvwn
    ndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngtflayaqfn
    dtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtnatsiqita
    pasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclvarqhiems
    ttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgtwevigiea
    ltsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsfskeakyyq
    lrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilnetkfwyqmi
    lpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgrgsgyqgdk
    imhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlgsgsgvfkc
    giavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyllihgtadd
    nvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikqcfslp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5kbyD (D:)
    adpggshhhhhhsrktytltdylkntyrlklyslrwisdheylykqennilvfnaeygns
    svflenstfdefghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqlitee
    ripnntqwvtwspvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeee
    vfsaysalwwspngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptv
    kffvvntdslssvtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmd
    icdydessgrwnclvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicy
    fqidkkdctfitkgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtcls
    celnpercqyysvsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqn
    vqmpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwaty
    lasteniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriai
    wgwsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrns
    tvmsraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasst
    ahqhiythmshfikqcfslp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbyD (D:)
    rktytltdylkntyrlklyslrwisdheylykqnilvfnaeygnssvflenstfdefghs
    indysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtwspvg
    hklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwspngt
    flayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslssvtn
    atsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwnclv
    arqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfitkgt
    wevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyysvsf
    skeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvqmpskkldfiilne
    tkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatylasteniivasfdgr
    gsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwgwsyggyvtsmvlg
    sgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstvmsraenfkqveyl
    lihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstahqhiythmshfikq
    cfslp