PDB entry 5kbx

View 5kbx on RCSB PDB site
Description: Co-crystal structure of the Saccharomyces cerevisiae histidine phosphotransfer signaling protein Ypd1 and the receiver domain of its downstream response regulator Ssk1
Class: signaling protein
Keywords: two-component signaling, phosphorelay, Ypd1, Ssk1, response regulator, histidine phosphotransfer protein, Saccharomyces cerevisiae, co-crystal, phosphotransfer, SIGNALING PROTEIN
Deposited on 2016-06-03, released 2017-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphorelay intermediate protein YPD1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YPD1, YDL235C, D0790
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5kbxa_
  • Chain 'B':
    Compound: Osmolarity two-component system protein SSK1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SSK1, YLR006C
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07084
      • engineered mutation (143)
    Domains in SCOPe 2.07: d5kbxb_
  • Heterogens: GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kbxA (A:)
    mstipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteld
    nlghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginided
    deeikiqvddkdensiyliliakalnqsrlefklarielskyyntnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbxA (A:)
    tipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldnl
    ghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginikdens
    iyliliakalnqsrlefklarielskyyntnl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kbxB (B:)
    ttsekvfpkinvlivednvinqailgsflrkhkisyklakngqeavniwkegglhlifmd
    lqlpvlsgieaakqirdfekqngigiqkslnnshsnlekgtskrfsqapviivaltasns
    qmdkrkallsgcndyltkpvnlhalskkitewgcmqalidfdswkqgesrmtdsvlvksp
    qkpiapsnphsfkqatsmtpthspvrknsnlsptqiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kbxB (B:)
    kvfpkinvlivednvinqailgsflrkhkisyklakngqeavniwkegglhlifmdlqlp
    vlsgieaakqirdfekqngigskrfsqapviivaltasnsqmdkrkallsgcndyltkpv
    nlhalskkitewgcmqalidfdswk