PDB entry 5kb6

View 5kb6 on RCSB PDB site
Description: High-resolution structure of the adenosine kinase from Mus musculus in complex with adenosine
Class: transferase
Keywords: Adenosine Kinase, TRANSFERASE
Deposited on 2016-06-02, released 2017-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenosine kinase
    Species: Mus musculus [TaxId:10090]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kb6a_
  • Chain 'B':
    Compound: adenosine kinase
    Species: Mus musculus [TaxId:10090]
    Gene: adk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5kb6b_
  • Heterogens: ADN, SO4, CL, PG4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5kb6A (A:)
    gsmaaadepkpkklkveapqalsenvlfgmgnplldisavvdkdfldkyslkpndqilae
    dkhkelfdelvkkfkveyhaggstqnsmkvaqwliqephkaatffgcigidkfgeilkrk
    aadahvdahyyeqneqptgtcaacitggnrslvanlaaancykkekhldlernwvlveka
    rvyyiagffltvspesvlkvaryaaennrvftlnlsapfisqffkealmdvmpyvdilfg
    neteaatfareqgfetkdikeiakkaqalpkvnskrqrtviftqgrddtivaaendvtaf
    pvldqnqeeiidtngagdafvggflsqlvsdkplteciraghyaasviirrtgctfpekp
    dfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kb6A (A:)
    alsenvlfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
    ggstqnsmkvaqwliqephkaatffgcigidkfgeilkrkaadahvdahyyeqneqptgt
    caacitggnrslvanlaaancykkekhldlernwvlvekarvyyiagffltvspesvlkv
    aryaaennrvftlnlsapfisqffkealmdvmpyvdilfgneteaatfareqgfetkdik
    eiakkaqalpkvnskrqrtviftqgrddtivaaendvtafpvldqnqeeiidtngagdaf
    vggflsqlvsdkplteciraghyaasviirrtgctfpekpdfh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5kb6B (B:)
    gsmaaadepkpkklkveapqalsenvlfgmgnplldisavvdkdfldkyslkpndqilae
    dkhkelfdelvkkfkveyhaggstqnsmkvaqwliqephkaatffgcigidkfgeilkrk
    aadahvdahyyeqneqptgtcaacitggnrslvanlaaancykkekhldlernwvlveka
    rvyyiagffltvspesvlkvaryaaennrvftlnlsapfisqffkealmdvmpyvdilfg
    neteaatfareqgfetkdikeiakkaqalpkvnskrqrtviftqgrddtivaaendvtaf
    pvldqnqeeiidtngagdafvggflsqlvsdkplteciraghyaasviirrtgctfpekp
    dfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5kb6B (B:)
    alsenvlfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
    ggstqnsmkvaqwliqephkaatffgcigidkfgeilkrkaadahvdahyyeqneqptgt
    caacitggnrslvanlaaancykkekhldlernwvlvekarvyyiagffltvspesvlkv
    aryaaennrvftlnlsapfisqffkealmdvmpyvdilfgneteaatfareqgfetkdik
    eiakkaqalpkvnskrqrtviftqgrddtivaaendvtafpvldqnqeeiidtngagdaf
    vggflsqlvsdkplteciraghyaasviirrtgctfpekpdfh