PDB entry 5ka9

View 5ka9 on RCSB PDB site
Description: Protein Tyrosine Phosphatase 1B L192A mutant in complex with TCS401, open state
Class: hydrolase
Keywords: Protein tyrosine phosphatase, HYDROLASE
Deposited on 2016-06-01, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN1, PTP1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18031 (5-End)
      • expression tag (0-4)
      • engineered mutation (196)
    Domains in SCOPe 2.07: d5ka9a1, d5ka9a2
  • Heterogens: GOL, CL, TRS, OTA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ka9A (A:)
    ghmasmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhs
    riklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvme
    kgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfh
    yttwpdfgvpespasfanflfkvresgslspehgpvvvhcsagigrsgtfcladtclllm
    dkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkels
    hedlep
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ka9A (A:)
    ghmasmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhs
    riklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvme
    kgslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfh
    yttwpdfgvpespasfanflfkvresgslspehgpvvvhcsagigrsgtfcladtclllm
    dkrkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkel