PDB entry 5k9s

View 5k9s on RCSB PDB site
Description: Importin-alpha in complex with HNF1-beta peptide
Class: transport protein
Keywords: Nuclear transport, transport protein
Deposited on 2016-06-01, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Importin subunit alpha-1
    Species: Mus musculus [TaxId:10090]
    Gene: Kpna2, Rch1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k9sa_
  • Chain 'B':
    Compound: HNF1 beta A splice variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HNF1B
    Database cross-references and differences (RAF-indexed):
    • PDB 5K9S (Start-6)
  • Chain 'C':
    Compound: HNF1 beta A splice variant 2
    Species: Homo sapiens [TaxId:9606]
    Gene: HNF1B
    Database cross-references and differences (RAF-indexed):
    • PDB 5K9S (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k9sA (A:)
    gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
    dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
    dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
    ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
    palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
    qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
    kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
    iekyfsveeeedqnvvpettsegfafqvqdgapgtfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k9sA (A:)
    vnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgktdc
    spiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniagdg
    safrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveqil
    ptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivtpa
    lraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiqqv
    vnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsakd
    tkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnlie
    kyfsv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.