PDB entry 5k9k

View 5k9k on RCSB PDB site
Description: Crystal structure of multidonor HV6-1-class broadly neutralizing Influenza A antibody 56.a.09 in complex with Hemagglutinin Hong Kong 1968.
Class: immune system
Keywords: Influenza, multidonor, H5, universal influenza vaccine, IMMUNE SYSTEM
Deposited on 2016-05-31, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.97 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 56.a.09 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K9K (0-228)
  • Chain 'B':
    Compound: 56.a.09 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K9K (0-214)
    Domains in SCOPe 2.07: d5k9kb1, d5k9kb2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7
      • conflict (217)
    Domains in SCOPe 2.07: d5k9kf1, d5k9kf2
  • Chain 'H':
    Compound: 56.a.09 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K9K (0-228)
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus (strain A/Hong Kong/1/1968 H3N2) [TaxId:506350]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q91MA7
      • conflict (217)
    Domains in SCOPe 2.07: d5k9ki1, d5k9ki2
  • Chain 'L':
    Compound: 56.a.09 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5K9K (0-214)
    Domains in SCOPe 2.07: d5k9kl1, d5k9kl2
  • Heterogens: NAG, BMA, MAN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k9kB (B:)
    eivltqspgtlslspgeratlscrasqsvassylawyqqkpgqaprlliygassratgvp
    drfsgsgsgtdfiltisrlepedfavyycqqydgsqytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5k9kF (F:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhqnseg
    tgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidl
    wsynaellvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacies
    irngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k9kF (F:)
    pgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgid
    ctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefite
    gftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvh
    hpstnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvl
    vinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkityg
    acpkyvkqntlklatgmrnvpekqrglfgaiagfiengwegmidgwygfrhqnsegtgqa
    adlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsyn
    aellvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirng
    tydhdvyrdealnnrfq
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5k9kI (I:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtrglfgaiagfiengwegmidgwygfrhqnseg
    tgqaadlkstqaaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidl
    wsynaellvalenqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnacies
    irngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k9kI (I:)
    ndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidct
    lidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegf
    twtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhp
    stnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvi
    nsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygac
    pkyvkqntlklatgmrnvpekqtiagfiengwegmidgwygfrhqnsegtgqaadlkstq
    aaidqingklnrviektnekfhqiekefsevegriqdlekyvedtkidlwsynaellval
    enqhtidltdsemnklfektrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvy
    rdealnnrfq
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k9kL (L:)
    eivltqspgtlslspgeratlscrasqsvassylawyqqkpgqaprlliygassratgvp
    drfsgsgsgtdfiltisrlepedfavyycqqydgsqytfgqgtkleikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec