PDB entry 5k89

View 5k89 on RCSB PDB site
Description: Crystal Structure of Human Calcium-Bound S100A1
Class: metal binding protein
Keywords: S100, S100A1, calcium, METAL BINDING PROTEIN
Deposited on 2016-05-27, released 2017-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-12, with a file datestamp of 2017-04-07.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5k89a_
  • Chain 'C':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5k89c_
  • Chain 'H':
    Compound: Protein S100-A1
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A1, S100A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5k89h_
  • Heterogens: TRS, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k89A (A:)
    mgseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmk
    eldengdgevdfqeyvvlvaaltvacnnffwens
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k89A (A:)
    mgseletametlinvfhahsgkegdkyklskkelkellqtelsgflddavdkvmkelden
    gdgevdfqeyvvlvaaltvacnnff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k89C (C:)
    mgseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmk
    eldengdgevdfqeyvvlvaaltvacnnffwens
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k89C (C:)
    seletametlinvfhahsgkegdkyklskkelkellqtelsgfldavdavdkvmkelden
    gdgevdfqeyvvlvaaltvacnnffwens
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5k89H (H:)
    mgseletametlinvfhahsgkegdkyklskkelkellqtelsgfldaqkdvdavdkvmk
    eldengdgevdfqeyvvlvaaltvacnnffwens
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k89H (H:)
    mgseletametlinvfhahsgkegdkyklskkelkellqtelsgflvdavdkvmkelden
    gdgevdfqeyvvlvaaltvacnnffwens