PDB entry 5k6j

View 5k6j on RCSB PDB site
Description: Human Phospodiesterase 4B in complex with pyridyloxy-benzoxaborole based inhibitor
Class: hydrolase
Keywords: phosphodiesterase, hydrolase
Deposited on 2016-05-24, released 2017-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B, DPDE4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k6ja_
  • Heterogens: ZN, MG, 6QQ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k6jA (A:)
    nedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymm
    tledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgv
    snqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidm
    vlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptksle
    lyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadl
    vqpdaqdildtlednrnwyqsmi