PDB entry 5k3j

View 5k3j on RCSB PDB site
Description: Crystals structure of Acyl-CoA oxidase-2 in Caenorhabditis elegans bound with FAD, ascaroside-CoA, and ATP
Class: oxidoreductase
Keywords: dauer pheromone; ascarosides; b-oxidation; ATP; crystal structure, OXIDOREDUCTASE
Deposited on 2016-05-19, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-2, CELE_F08A8.2, F08A8.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62137 (Start-660)
      • conflict (431)
      • expression tag (661-663)
    Domains in SCOPe 2.07: d5k3ja1, d5k3ja2, d5k3ja3, d5k3ja4
  • Chain 'B':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-2, CELE_F08A8.2, F08A8.2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62137 (Start-660)
      • conflict (431)
      • expression tag (661-664)
    Domains in SCOPe 2.07: d5k3jb1, d5k3jb2, d5k3jb3, d5k3jb4
  • Heterogens: FAD, ATP, 6QA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k3jA (A:)
    manrsirdgdnpelleerrmatfdtdkmaaviygseefarrrreitdavskipeladikp
    ypfltreekvtegtrkisiltkylnqlidrdneeeslhlhrevigyeghpfalhdalfip
    tlqsqasdeqqekwlerarrreiigcyaqtelghgsnlrnlettavydiasqefvlhtpt
    ttalkwwpgalgkscnyalvvaeliikrnnygphffmvqlrdekthiplkgvtvgdigpk
    mnfnaadngylglnnlrvprtnllmrhckveadgtyvkpphakigysgmvkirsqmameq
    glflahaltiaarysavrrqghlddkqvevkvldyqtqqhrlfpslarayafiftgfeti
    hlysqllkdvdmgntsgmadlhaltsglksvvahetgegieqarmacgghgysmasyisv
    vygiaiggctyagenmvmllqlarylvksvelikagkakklgpvasyladksdetdltsl
    ngyvkmfenmarrqawkatekflklmesgesrevawnksaveltrasrlhtrlfiieafm
    rrvsriedipvkevltdllhlhvnyelldvatyalefmsftqldyvrdqlylylekirpn
    avslvdsfqisdmqlrsvlgrrdghvyenlfkwakssplnnadvlpsvekylkpmmekak
    laaahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3jA (A:)
    nrsirdgdnpelleerrmatfdtdkmaaviygseefarrrreitdavskipeladikpyp
    fltreekvtegtrkisiltkylnqlidrdneeeslhlhrevigyeghpfalhdalfiptl
    qsqasdeqqekwlerarrreiigcyaqtelghgsnlrnlettavydiasqefvlhtpttt
    alkwwpgalgkscnyalvvaeliikrnnygphffmvqlrdekthiplkgvtvgdigpkmn
    fnaadngylglnnlrvprtnllmrhckveadgtyvkpphakigysgmvkirsqmameqgl
    flahaltiaarysavrrqghlddkqvevkvldyqtqqhrlfpslarayafiftgfetihl
    ysqllkdvdmgntsgmadlhaltsglksvvahetgegieqarmacgghgysmasyisvvy
    giaiggctyagenmvmllqlarylvksvelikagkakklgpvasyladksdetdltslng
    yvkmfenmarrqawkatekflklmesgesrevawnksaveltrasrlhtrlfiieafmrr
    vsriedipvkevltdllhlhvnyelldvatyalefmsftqldyvrdqlylylekirpnav
    slvdsfqisdmqlrsvlgrrdghvyenlfkwakssplnnadvlpsvekylkpmmekakla
    aa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k3jB (B:)
    manrsirdgdnpelleerrmatfdtdkmaaviygseefarrrreitdavskipeladikp
    ypfltreekvtegtrkisiltkylnqlidrdneeeslhlhrevigyeghpfalhdalfip
    tlqsqasdeqqekwlerarrreiigcyaqtelghgsnlrnlettavydiasqefvlhtpt
    ttalkwwpgalgkscnyalvvaeliikrnnygphffmvqlrdekthiplkgvtvgdigpk
    mnfnaadngylglnnlrvprtnllmrhckveadgtyvkpphakigysgmvkirsqmameq
    glflahaltiaarysavrrqghlddkqvevkvldyqtqqhrlfpslarayafiftgfeti
    hlysqllkdvdmgntsgmadlhaltsglksvvahetgegieqarmacgghgysmasyisv
    vygiaiggctyagenmvmllqlarylvksvelikagkakklgpvasyladksdetdltsl
    ngyvkmfenmarrqawkatekflklmesgesrevawnksaveltrasrlhtrlfiieafm
    rrvsriedipvkevltdllhlhvnyelldvatyalefmsftqldyvrdqlylylekirpn
    avslvdsfqisdmqlrsvlgrrdghvyenlfkwakssplnnadvlpsvekylkpmmekak
    laaahhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3jB (B:)
    anrsirdgdnpelleerrmatfdtdkmaaviygseefarrrreitdavskipeladikpy
    pfltreekvtegtrkisiltkylnqlidrdneeeslhlhrevigyeghpfalhdalfipt
    lqsqasdeqqekwlerarrreiigcyaqtelghgsnlrnlettavydiasqefvlhtptt
    talkwwpgalgkscnyalvvaelnygphffmvqlrdekthiplkgvtvgdigpkmnfnaa
    dngylglnnlrvprtnllmrhckveadgtyvkpphakigysgmvkirsqmameqglflah
    altiaarysavrrqghlddkqvevkvldyqtqqhrlfpslarayafiftgfetihlysql
    lkdvdmgntsgmadlhaltsglksvvahetgegieqarmacgghgysmasyisvvygiai
    ggctyagenmvmllqlarylvksvelikagkakklgpvasyladksdetdltslngyvkm
    fenmarrqawkatekflklmesgesrevawnksaveltrasrlhtrlfiieafmrrvsri
    edipvkevltdllhlhvnyelldvatyalefmsftqldyvrdqlylylekirpnavslvd
    sfqisdmqlrsvlgrrdghvyenlfkwakssplnnadvlpsvekylkpmmekaklaaah