PDB entry 5k3i

View 5k3i on RCSB PDB site
Description: Crystal structure of Acyl-CoA oxidase-1 in Caenorhabditis elegans complexed with FAD and ATP
Class: oxidoreductase
Keywords: dauer pheromone, ascarosides, b-oxidation, ATP, OXIDOREDUCTASE
Deposited on 2016-05-19, released 2016-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62140
      • engineered mutation (433)
  • Chain 'B':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62140
      • engineered mutation (433)
  • Chain 'C':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62140
      • engineered mutation (433)
    Domains in SCOPe 2.06: d5k3ic1, d5k3ic2, d5k3ic3
  • Chain 'D':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62140
      • engineered mutation (433)
    Domains in SCOPe 2.06: d5k3id1, d5k3id2, d5k3id3
  • Chain 'E':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62140
      • engineered mutation (433)
  • Chain 'F':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62140
      • engineered mutation (433)
    Domains in SCOPe 2.06: d5k3if1, d5k3if2, d5k3if3
  • Chain 'G':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62140
      • engineered mutation (433)
    Domains in SCOPe 2.06: d5k3ig1, d5k3ig2, d5k3ig3
  • Chain 'H':
    Compound: Acyl-coenzyme A oxidase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: acox-1, CELE_F08A8.1, F08A8.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O62140
      • engineered mutation (433)
  • Heterogens: FAD, ATP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5k3iC (C:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyagenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3iC (C:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptgelyhlnnevlgiegnpmalhgvmfipa
    lnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtpki
    talkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigpkm
    aynivdngflgfnnyriprtnllmrhtkveadgtyikppamvhvrsymltgqaimlsyal
    niatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervlk
    emslmadlhaltsglksvvthqtgegieqarmacgghgysmasyiseiygvaiggctyag
    enmvmllqlarylvksaalvksgkasqlgplvaylgarseptslidrviteyiktfqhia
    krqtlkaankffglmengekreiawnkssvelnrasrlhtrlfiveafarrvneigditi
    kealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfylqkirpnavslldswe
    fsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5k3iD (D:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyagenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3iD (D:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikppamvhvrsymltgqaimlsy
    alniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyerv
    lkemkslmadlhaltsglksvvthqtgegieqarmacgghgysmasyiseiygvaiggct
    yagenmvmllqlarylvksaalvksgkasqlgplvaylgarseptslidrviteyiktfq
    hiakrqtlkaankffglmengekreiawnkssvelnrasrlhtrlfiveafarrvneigd
    itikealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfylqkirpnavslld
    swefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5k3iF (F:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyagenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3iF (F:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyamvhvrsymltgqaimlsyalni
    atrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervlkem
    ksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyiseiygvaiggct
    yagenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsliditeyiktfqhi
    akrqtlkaankffglmengekreiawnkssvelnrasrlhtrlfiveafarrvneigdit
    ikealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfylqkirpnavslldsw
    efsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5k3iG (G:)
    mvhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhds
    mplpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmf
    ipalnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlht
    pkitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdig
    pkmaynivdngflgfnnyriprtnllmrhtkveadgtyikpphakinysamvhvrsymlt
    gqaimlsyalniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagae
    tvklyervlkemksgnvslmadlhaltsglksvvthqtgegieqarmacgghgysmasyi
    seiygvaiggctyagenmvmllqlarylvksaalvksgkasqlgplvaylgarseptsli
    drvpnggiteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtr
    lfiveafarrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdql
    yfylqkirpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdt
    ylkpmmekarqsklhhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3iG (G:)
    vhlnktiqegdnpdltaerltatfdthamaaqiyggemrarrrreitaklaeipelhdsm
    plpymtreekimesarkltvltqrmseiidptdagelyhlnnevlgiegnpmalhgvmfi
    palnaqasdeqqakwliralrreiigtyaqtemghgtnlqnlettatydigtqefvlhtp
    kitalkwwpgnlgkssnyavvvahmyikgknfgphtfmvplrdekthkplpgitigdigp
    kmaynivdngflgfnnyriprtnllmrhtkveadgtyikpamvhvrsymltgqaimlsya
    lniatrysavrrqgqidknepevkvleyqtqqhrlfpfiarayafqfagaetvklyervl
    kemksglmadlhaltsglksvvthqtgegieqarmacgghgysmasyiseiygvaiggct
    yagenmvmllqlarylvksaalvksgkasqlgplvaylgarseptslidrgiteyiktfq
    hiakrqtlkaankffglmengekreiawnkssvelnrasrlhtrlfiveafarrvneigd
    itikealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfylqkirpnavslld
    swefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylkpmmeka
    

  • Chain 'H':
    No sequence available.