PDB entry 5k3f

View 5k3f on RCSB PDB site
Description: Crystal Structure of the Fluoroacetate Dehalogenase RPA1163 - His280Asn/Fluoroacetate - Cocrystallized - Single Protomer Reacted with Ligand
Class: hydrolase
Keywords: Homodimer, Hydrolase, Dehalogenase
Deposited on 2016-05-19, released 2017-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) [TaxId:258594]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1
      • engineered mutation (281)
    Domains in SCOPe 2.07: d5k3fa_
  • Chain 'B':
    Compound: Fluoroacetate Dehalogenase
    Species: Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) [TaxId:258594]
    Gene: RPA1163
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NAM1
      • engineered mutation (281)
    Domains in SCOPe 2.07: d5k3fb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k3fA (A:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3fA (A:)
    ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
    dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
    pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
    swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
    mlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrffsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5k3fB (B:)
    ghmpdladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerf
    kvivadlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyr
    laldspgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyv
    kaklaswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagn
    kipvpmlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrff
    saapgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k3fB (B:)
    dladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviv
    adlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlald
    spgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakl
    aswtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipv
    pmlalwgasgaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrffs