PDB entry 5k35

View 5k35 on RCSB PDB site
Description: Structure of the Legionella effector, AnkB, in complex with human Skp1
Class: protein binding
Keywords: bacterial effector, host-pathogen interaction, F-box protein, ankyrin repeats, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, PROTEIN BINDING
Deposited on 2016-05-19, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ankyrin-repeat protein B
    Species: Legionella pneumophila [TaxId:446]
    Gene: ankB
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: S-phase kinase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SKP1, EMC19, OCP2, SKP1A, TCEB1L
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k35b1, d5k35b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >5k35B (B:)
mpsiklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviq
wcthhkddppppeddenkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtc
ktvanmikgktpeeirktfnikndfteeeeaqvrkenqwceek

    Sequence, based on observed residues (ATOM records): (download) 
    >5k35B (B:)
psiklqssdgeifevdveiakqsvtiktmledlgmdddpvplpnvnaailkkviqwcthh
kddpekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpee
irktfnikndfteeeeaqvrkenqwc