PDB entry 5k0u

View 5k0u on RCSB PDB site
Description: CryoEM structure of the full virion of a human rhinovirus C
Class: virus
Keywords: virus, jelly roll
Deposited on 2016-05-17, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: EM
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Rhinovirus C [TaxId:463676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E5D8F2 (Start-278)
      • engineered mutation (124)
    Domains in SCOPe 2.07: d5k0ua_
  • Chain 'B':
    Compound: capsid protein vp3
    Species: Rhinovirus C [TaxId:463676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5k0ub_
  • Chain 'C':
    Compound: capsid protein VP2
    Species: Rhinovirus C [TaxId:463676]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: capsid protein VP4
    Species: Rhinovirus C [TaxId:463676]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5k0uA (A:)
    nnddpvenfvestlkevlvvpdtkpsgpqhttkpsilgameigassnatpestietryvy
    ntntnaeadvemflgrsalwgkvtltrqyakweinfqeqahirkkfefftylrfdmevti
    vtnnkglmqimfvppgidhpethddrkwdsasnpsvffqpksgfprftipftglasayym
    fydgydkpkgsdnneygiaptndmgllcfrtldnsggndvkiyvkpkhitawvprpprat
    qythkystnyhykpnssgpdehvlkdrhfiktrplissa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5k0uA (A:)
    vlvvpdtkpsgpqhttkpsilgameigassnatpestietryvyntntnaeadvemflgr
    salwgkvtltrqyakweinfqeqahirkkfefftylrfdmevtivtnnkglmqimfvppg
    idhpethddrkwdsasnpsvffqpksgfprftipftglasayymfydgydkpkgsdnney
    giaptndmgllcfrtldnsggndvkiyvkpkhitawvprppratqythkystnyhykpns
    sgpdehvlkdrhfiktrplissa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k0uB (B:)
    glptrlpsgsqqfmttedeqspnilpgfhpskkihipgmitnvmhmarvdsfipinniqg
    evgkvsmyyitvtkktvterilvlplemsntlfattllgevlnyyanwsgsititfmcvc
    dafstgkflvaytppggklpedrkqamlgvhiiwdlglqssctivvpwissgfyrrtkad
    sfthggyvslwyqtafvppvsggtgsilatcsacpdmsvrmlrdspmmeqknelq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.