PDB entry 5k01

View 5k01 on RCSB PDB site
Description: Crystal Structure of COMT in complex with 2,7-dimethyl-3-(1H-pyrazol-3-yl)imidazo[1,2-a]pyridine
Class: transferase
Keywords: METHYLTRANSFERASE, NEUROTRANSMITTER DEGRADATION, CATECHOL, transferase
Deposited on 2016-05-17, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol O-methyltransferase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: COMT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22734 (0-213)
      • conflict (8-9)
      • conflict (11)
      • conflict (13)
      • conflict (15)
      • conflict (18-19)
      • conflict (31)
      • conflict (42)
      • conflict (45)
      • conflict (47)
      • conflict (52)
      • conflict (54-55)
      • conflict (58-59)
      • conflict (78)
      • conflict (84)
      • conflict (86)
      • conflict (98)
      • conflict (100-101)
      • conflict (105-106)
      • conflict (111-113)
      • conflict (119)
      • conflict (153)
      • conflict (170)
      • conflict (173)
      • conflict (179)
      • conflict (185)
      • conflict (192)
      • conflict (194)
      • conflict (198-199)
      • conflict (210)
      • conflict (213)
    Domains in SCOPe 2.07: d5k01a_
  • Heterogens: 6OW, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5k01A (A:)
    dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
    lelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqdl
    ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
    vrgsssfecthyssyleymkvvdglekaiyqgps