PDB entry 5jzg

View 5jzg on RCSB PDB site
Description: CryoEM structure of the native empty particle of a human rhinovirus C
Class: virus
Keywords: virus, jelly roll
Deposited on 2016-05-16, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: EM
Resolution: 3.16 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Capsid protein VP1
    Species: Rhinovirus C [TaxId:463676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot E5D8F2 (Start-278)
      • engineered mutation (124)
  • Chain 'B':
    Compound: capsid protein vp3
    Species: Rhinovirus C [TaxId:463676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jzgb_
  • Chain 'C':
    Compound: capsid protein VP0
    Species: Rhinovirus C [TaxId:463676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jzgc_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jzgB (B:)
    glptrlpsgsqqfmttedeqspnilpgfhpskkihipgmitnvmhmarvdsfipinniqg
    evgkvsmyyitvtkktvterilvlplemsntlfattllgevlnyyanwsgsititfmcvc
    dafstgkflvaytppggklpedrkqamlgvhiiwdlglqssctivvpwissgfyrrtkad
    sfthggyvslwyqtafvppvsggtgsilatcsacpdmsvrmlrdspmmeqknelq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jzgC (C:)
    gaqvsrqnngthengvtasngsvikyfninyykdsassglsrqdfsqdpskftqplvdtl
    tnpalmspsveacgysdrlkqitignstittqdslhtvlaygewptylsdidatsvdkpt
    hpetsadrfytldsvewqvgshgwwwklpdalkdmgvfgqnmyyhsmgrsgfiihtqcna
    tkfhsgalivavipehqlayvggvkvnvgydhthpgqsghqirgpsqsndrsggkpdedp
    lfncngtllgnitifphqiinlrtnnsstivvpyincvpmdnmlkhnnlslviiplvplr
    pgssginsvpitvtiapyksefsgameaqrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jzgC (C:)
    gaqvssvikyfninyykdsassglsrqdfsqdpstltnpalmspsveacgysdrqitign
    stittslhtvlaygewptylsdidatsvdkpthpetsadrfytldsvewqvgshgwwwkl
    pdalkdmgvfgqnmyyhsmgrsgfiihtqcnatkfhsgalivavipehqlayvggvkvnv
    gydhthpgqsghqirgpsqsndrsggkpdedplfncngtllgnitifphqiinlrtnnss
    tivvpyincvpmdnmlkhnnlslviiplvplrpgssginsvpitvtiapyksefsgamea
    qrq