PDB entry 5jze

View 5jze on RCSB PDB site
Description: Erve virus viral OTU domain protease in complex with mouse ISG15
Class: hydrolase
Keywords: vOTU, ISG15, nairovirus, protease, HYDROLASE
Deposited on 2016-05-16, released 2016-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-19, with a file datestamp of 2016-10-14.
Experiment type: XRAY
Resolution: 2.47 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-dependent RNA polymerase
    Species: Erve virus [TaxId:248062]
    Gene: RdRp
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jzeb_
  • Chain 'C':
    Compound: RNA-dependent RNA polymerase
    Species: Erve virus [TaxId:248062]
    Gene: RdRp
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-like protein ISG15
    Species: Mus musculus [TaxId:10090]
    Gene: ISG15, G1P2, UCRP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jzed_
  • Heterogens: AYE, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jzeB (B:)
    plsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellgey
    glkpqctvikhlrlrg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5jzeD (D:)
    plsilvrnerghsniyevfltqtvdtlkkkvsqreqvhedqfwlsfegrpmedkellgey
    glkpqctvikhlrlrg