PDB entry 5jys

View 5jys on RCSB PDB site
Description: Pry1 CAP domain
Class: transport protein
Keywords: CAP protein, TRANSPORT PROTEIN
Deposited on 2016-05-15, released 2016-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein PRY1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: PRY1, YJL079C, J1022
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5jysa_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jysA (A:)
    klsklsiltsalatsalaapavvtvtehaheaavvtvqgvvyvengqtrttyetlapast
    atptstatalvappvapssassnsdvvlsalknlasvwgkttdstttltssestsqslaq
    atttstpaaasttstpaattttsqaaatssasssdsdlsdfassvlaehnkkralhkdtp
    alswsdtlasyaqdyadnydcsgtlthsggpygenlalgydgpaavdawyneisnydfsn
    pgfssntghftqvvwksttqvgcgiktcggawgdyvicsydpagnyegeyadnvepla
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jysA (A:)
    lsdfassvlaehnkkralhkdtpalswsdtlasyaqdyadnydcsgtlthsggpygenla
    lgydgpaavdawyneisnydfsnpgfssntghftqvvwksttqvgcgiktcggawgdyvi
    csydpagnyegeyadnvepla