PDB entry 5jyc

View 5jyc on RCSB PDB site
Description: Crystal structure of the E153Q mutant of the CFTR inhibitory factor Cif containing the adducted 14,15-EET hydrolysis intermediate
Class: hydrolase
Keywords: epoxide hydrolase, hydroxyalkyl-enzyme intermediate, HYDROLASE
Deposited on 2016-05-13, released 2017-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CFTR inhibitory factor
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL26 (0-End)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d5jyca_
  • Chain 'B':
    Compound: CFTR inhibitory factor
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL26 (0-End)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d5jycb_
  • Chain 'C':
    Compound: CFTR inhibitory factor
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL26 (0-End)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d5jycc_
  • Chain 'D':
    Compound: CFTR inhibitory factor
    Species: Pseudomonas aeruginosa (strain UCBPP-PA14) [TaxId:208963]
    Gene: PA14_26090
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KL26 (0-End)
      • engineered mutation (128)
    Domains in SCOPe 2.07: d5jycd_
  • Heterogens: EET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jycA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jycA (A:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jycB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jycB (B:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jycC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jycC (C:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jycD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jycD (D:)
    aeefpvpngfesayrevdgvklhyvkggqgplvmlvhgfgqtwyewhqlmpelakrftvi
    apdlpglgqseppktgysgeqvavylhklarqfspdrpfdlvahdigiwntypmvvknqa
    diarlvymqapipdariyrfpaftaqgeslvwhfsffaaddrlaetliagkerfflehfi
    kshasntevfserlldlyarsyakphslnasfeyyralnesvrqnaelaktrlqmptmtl
    aggghggmgtfqleqmkayaedveghvlpgcghwlpeecaapmnrlvidflsrgrhh