PDB entry 5jy3

View 5jy3 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF LXRbeta (NUCLEAR RECEPTOR SUBFAMILY 1, GROUP H, MEMBER 2) COMPLEXED WITH BMS-852927
Class: transcription
Keywords: nhr, nr1h2, lxr-b, lxrb, unr, ner-I, rip15, ner, transcription
Deposited on 2016-05-13, released 2016-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-11-02, with a file datestamp of 2016-10-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jy3a_
  • Chain 'B':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jy3b_
  • Chain 'C':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jy3c_
  • Chain 'D':
    Compound: oxysterols receptor lxr-beta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1H2, LXRB, NER, UNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jy3d_
  • Heterogens: 6OX, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jy3A (A:)
    mhhhhhhgenlyfqgsegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgad
    pqsrdarqqrfahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlleta
    rrynhetecitflkdftyskddfhraglqvefinpifefsramrrlglddaeyalliain
    ifsadrpnvqepgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhse
    qvfalrlqdkklppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jy3A (A:)
    qltaaqelmiqqlvaaqlqcnkrpkvtpwprdarqqrfahftelaiisvqeivdfakqvp
    gflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqvefi
    npifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytrik
    rpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5jy3B (B:)
    mhhhhhhgenlyfqgsegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgad
    pqsrdarqqrfahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlleta
    rrynhetecitflkdftyskddfhraglqvefinpifefsramrrlglddaeyalliain
    ifsadrpnvqepgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhse
    qvfalrlqdkklppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jy3B (B:)
    qltaaqelmiqqlvaaqlqcnkrsfpkvtpwprdarqqrfahftelaiisvqeivdfakq
    vpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqve
    finpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytr
    ikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5jy3C (C:)
    mhhhhhhgenlyfqgsegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgad
    pqsrdarqqrfahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlleta
    rrynhetecitflkdftyskddfhraglqvefinpifefsramrrlglddaeyalliain
    ifsadrpnvqepgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhse
    qvfalrlqdkklppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jy3C (C:)
    qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwppqsrdarqqrfahftelaiisvqei
    vdfakqvpgflqlgredqiallkastieimlletarrynhetecitflftyskddfhrag
    lqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveall
    sytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlklppllseiwd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5jy3D (D:)
    mhhhhhhgenlyfqgsegegvqltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgad
    pqsrdarqqrfahftelaiisvqeivdfakqvpgflqlgredqiallkastieimlleta
    rrynhetecitflkdftyskddfhraglqvefinpifefsramrrlglddaeyalliain
    ifsadrpnvqepgrvealqqpyveallsytrikrpqdqlrfprmlmklvslrtlssvhse
    qvfalrlqdkklppllseiwdvhe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jy3D (D:)
    qltaaqelmiqqlvaaqlqcnkrkvtpwprdarqqrfahftelaiisvqeivdfakqvpg
    flqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqvefin
    pifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytrikr
    pqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd