PDB entry 5jww

View 5jww on RCSB PDB site
Description: T4 Lysozyme L99A/M102Q with 1-Hydro-2-ethyl-1,2-azaborine Bound
Class: hydrolase
Keywords: Phage lysozyme Azaborine, HYDROLASE
Deposited on 2016-05-12, released 2016-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-09-28, with a file datestamp of 2016-09-23.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endolysin
    Species: Enterobacteria phage T4 sensu lato [TaxId:348604]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered mutation (11)
      • engineered mutation (37)
      • engineered mutation (98)
      • engineered mutation (101)
      • engineered mutation (136)
      • engineered mutation (143)
    Domains in SCOPe 2.08: d5jwwa_
  • Heterogens: CL, 6OQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jwwA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspdlnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpdrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jwwA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspdlnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpdrakrvittfrtgtwday