PDB entry 5jwk

View 5jwk on RCSB PDB site
Description: Factor Inhibiting HIF D201E in Complex with Fe, and Alpha-Ketoglutarate
Class: oxidoreductase
Keywords: Hypoxia Inducible Factor, Factor Inhibiting HIF, Oxygenase, Oxygen Sensing, OXIDOREDUCTASE
Deposited on 2016-05-12, released 2017-05-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: HIF1AN, FIH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWT6 (Start-351)
      • engineered mutation (203)
    Domains in SCOPe 2.06: d5jwka_
  • Heterogens: AKG, PEG, FE2, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jwkA (A:)
    gshmaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelie
    neepvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkpr
    snreemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkr
    gwgqltsnllligmegnvtpahyeeqqnffaqikgykrcilfppdqfeclypypvhhpcd
    rqsqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwy
    kgaptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jwkA (A:)
    vasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtn
    lvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhef
    veklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlll
    igmegnvtpahyeeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpd
    yerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkriey
    plkahqkvaimrniekmlgealgnpqevgpllntmikgryn