PDB entry 5jvn

View 5jvn on RCSB PDB site
Description: C3-type pyruvate phosphate dikinase: intermediate state of the central domain in the swiveling mechanism
Class: transferase
Keywords: phosphotransferase, nucleotide binding, conformational transition, swiveling mechanism, transferase
Deposited on 2016-05-11, released 2017-04-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate, phosphate dikinase, chloroplastic
    Species: FLAVERIA PRINGLEI [TaxId:4226]
    Gene: PPDK, PDK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q42736 (1-874)
      • expression tag (0)
    Domains in SCOPe 2.06: d5jvna1, d5jvna2, d5jvna3, d5jvna4
  • Heterogens: 6NQ, PEP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jvnA (A:)
    akkrvftfgkgrsegnkdmksllggkganlaemasiglsvppgltisteaceeyqqngkk
    lppglwdeileglryvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevv
    aglagksgarfaydsyrrfldmfgnvvmgiphslfdekleemkaekgvhldtdltaadlk
    dlveqyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavn
    iqcmvfgnmgntsgtgvlftrnpstgekklygeflvnaqgedvvagirtpedlatmetcm
    peayrelvenckilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegl
    idtrtaikrvetqhldqllhpqfenpsaykshvvatglpaspgaavgqvvfsaedaetwh
    aqgksailvrtetspedvggmhaaagiltarggmtshaavvargwgkccvsgcadirvnd
    dmkvltigdrvikegdwlslngstgevilgkqllappamsndletfmswadqvrrlkvma
    nadtpndaltarnngaqgiglcrtehmffasderikavrkmimavtpeqrkaaldlllpy
    qrsdfegiframdglpvtirlldpplheflpegdlehivnelavdtgmsedeiyskiekl
    sevnpmlgfrgcrlgisypeltemqvraifqaavsmnnqgvtvipeimvplvgtpqelrh
    qigvirgvaanvfaemgltmdykvgtmieipraaliaeeiakeaeffsfgtndltqmtfg
    ysrddvgkflqiylsqgilqhdpfevldqkgvgqlikmatekgraanpnlkvgicgehgg
    epssvaffdgvgldyvscspfrvpiarlaaaqvvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jvnA (A:)
    akkrvftfgkgrsegnkdmksllggkganlaemasiglsvppgltisteaceeyqqngkk
    lppglwdeileglryvqkemsaslgdpskplllsvrsgaaismpgmmdtvlnlglndevv
    aglagksgarfaydsyrrfldmfgnvvmgiphslfdekleemkaekgvhldtdltaadlk
    dlveqyknvyveakgekfptdpkkqlelavnavfdswdsprankyrsinqitglkgtavn
    iqcmvfgnmgntsgtgvlftrnpstgekklygeflvnaqgedvvagirtpedlatmetcm
    peayrelvenckilerhykdmmdieftvqenrlwmlqcrtgkrtgkgavriavdmvnegl
    idtrtaikrvetqhldqllhpqfenpsaykshvvatglpaspgaavgqvvfsaedaetwh
    aqgksailvrtetspedvggmhaaagiltarggmtshaavvargwgkccvsgcadirvnd
    dmkvltirvikegdwlslngstgevilgkqllappamsndletfmswadqvrrlkvmana
    dtpndaltarnngaqgiglcrtehmffasderikavrkmimavtpeqrkaaldlllpyqr
    sdfegiframdglpvtirlldpplheflpegdlehivnelavdtgmsedeiyskieklse
    vnpmlgfrgcrlgisypeltemqvraifqaavsmnnqgvtvipeimvplvgtpqelrhqi
    gvirgvaanvfaemgltmdykvgtmieipraaliaeeiakeaeffsfgtndltqmtfgys
    rddvgkflqiylsqgilqhdpfevldqkgvgqlikmatekgraanpnlkvgicgehggep
    ssvaffdgvgldyvscspfrvpiarlaaaqvvv