PDB entry 5juv

View 5juv on RCSB PDB site
Description: STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose
Class: hydrolase
Keywords: TIM barrel, GH35, GLYCOSIDE HYDROLASE, KINETICS, PROTEIN CONFORMATION, carbohydrate metabolism, b-galactosidase, Aspergillus niger, fungal protein, SUBSTRATE SPECIFICITY, prebiotics, galactooligosaccharides, GOS, recombinant, 6-O-beta-D-Galactopyranosyl-D-galactose, 6-b-Galactopyranosyl galactose, 6-Gal-Gal, HYDROLASE
Deposited on 2016-05-10, released 2017-04-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-04-19, with a file datestamp of 2017-04-14.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable beta-galactosidase A
    Species: Aspergillus niger CBS 513.88 [TaxId:425011]
    Gene: lacA, An01g12150
    Database cross-references and differences (RAF-indexed):
    • Uniprot A2QAN3 (Start-1006)
      • engineered mutation (297)
      • expression tag (1007)
    Domains in SCOPe 2.06: d5juva1, d5juva2, d5juva3, d5juva4, d5juva5, d5juva6
  • Heterogens: NAG, BMA, MAN, CL, 1PE, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5juvA (A:)
    mklssacaiallaaqaagasikhringftltehsdpakrellqkyvtwddkslfingeri
    mifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwalvegkpgeyradgifdlepf
    fdaaseagiyllarpgpyinaessgggfpgwlqrvngtlrssdkayldatdnyvshvaat
    iakyqitnggpiilyqpeneytsgccgvefpdpvymqyvedqarnagvviplinndasas
    gnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptnfrtlhleqspttpyaivqfq
    ggsydpwggpgfaacsellnnefervfykndfsfqiaimnlymifggtnwgnlgypngyt
    sydygsavtesrnitrekyselkllgnfakvspgyltaspgnlttsgyadttdltvtpll
    gnstgsffvvrhsdysseestsyklrlptsagsvtipqlggtltlngrdskihvtdynvs
    gtniiystaevftwkkfadgkvlvlyggagehhelaistksnvtviegsesgisskqtss
    svvvgwdvsttrriiqvgdlkillldrnsaynywvpqlatdgtspgfstpekvassiivk
    agylvrtaylkgsglyltadfnattsvevigvpstaknlfingdktshtvdkngiwsatv
    dynapdislpslkdldwkyvdtlpeiqssyddslwpaadlkqtkntlrslttptslyssd
    ygfhtgyllyrghftatgnestfaidtqggsafgssvwlngtylgswtglyansdynaty
    nlpqlqagktyvitvvidnmgleenwtvgedlmktprgilnfllagrpssaiswkltgnl
    ggedyedkvrgplnegglyaerqgfhqpeppsqnwkssspleglseagigfysasfdldl
    pkgwdvplflnignsttpspyrvqvyvngyqyakyisnigpqtsfpvpegilnyrgtnwl
    avtlwaldsaggkleslelsyttpvltalgevesvdqpkykkrkgayhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5juvA (A:)
    llqkyvtwddkslfingerimifsgefhpfrlpvkelqldifqkvkalgfncvsfyvdwa
    lvegkpgeyradgifdlepffdaaseagiyllarpgpyinaessgggfpgwlqrvngtlr
    ssdkayldatdnyvshvaatiakyqitnggpiilyqpeneytsgccgvefpdpvymqyve
    dqarnagvviplinndasasgnnapgtgkgavdiyghdsyplgfdcanptvwpsgdlptn
    frtlhleqspttpyaivqfqggsydpwggpgfaacsellnnefervfykndfsfqiaimn
    lymifggtnwgnlgypngytsydygsavtesrnitrekyselkllgnfakvspgyltasp
    gnlttsgyadttdltvtpllgnstgsffvvrhsdysseestsyklrlptsagsvtipqlg
    gtltlngrdskihvtdynvsgtniiystaevftwkkfadgkvlvlyggagehhelaistk
    snvtviegsesgisskqtsssvvvgwdvsttrriiqvgdlkillldrnsaynywvpqlat
    dgtspgfstpekvassiivkagylvrtaylkgsglyltadfnattsvevigvpstaknlf
    ingdktshtvdkngiwsatvdynapdislpslkdldwkyvdtlpeiqssyddslwpaadl
    kqtkntlrslttptslyssdygfhtgyllyrghftatgnestfaidtqggsafgssvwln
    gtylgswtglyansdynatynlpqlqagktyvitvvidnmgleenwtvgedlmktprgil
    nfllagrpssaiswkltgnlggedyedkvrgplnegglyaerqgfhqpeppsqnwksssp
    leglseagigfysasfdldlpkgwdvplflnignsttpspyrvqvyvngyqyakyisnig
    pqtsfpvpegilnyrgtnwlavtlwaldsaggkleslelsyttpvltalgevesvdqpky
    kkrkgayh