PDB entry 5jsy

View 5jsy on RCSB PDB site
Description: The 3D structure of the Ni-reconstituted U489C variant of [NiFeSe] hydrogenase from Desulfovibrio vulgaris Hildenborough at 1.04 Angstrom resolution
Class: oxidoreductase
Keywords: nifese-site h2 cleavage/production, oxidoreductase
Deposited on 2016-05-09, released 2017-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-03-22, with a file datestamp of 2017-03-17.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic [nifese] hydrogenase, small subunit
    Species: Desulfovibrio vulgaris str. Hildenborough [TaxId:882]
    Gene: hysB, DVU_1917
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5jsya_
  • Chain 'B':
    Compound: periplasmic [nifese] hydrogenase, large subunit, selenocysteine-containing
    Species: Desulfovibrio vulgaris str. Hildenborough [TaxId:882]
    Gene: hysA, DVU_1918
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q72AS3
      • engineered mutation (485)
  • Heterogens: SF4, FCO, NI, FE2, H2S, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5jsyA (A:)
    msltrrdfvklctgtvagfgisqmfhpavhealagtltgerppvfwlqgqgctgcsvtll
    nsvhpsiadvllkvislefhptvmawegehaiehmrkvaekfkgkfflviegsvpveadg
    kyciigeanhheismvdalkefgpnaaavlavgtcaayggipaaegsetgatavskflgd
    ngiktpvvnipgcpphpdwivgtvvlaldaikknglegglaevvkvldsdgrptpffgrn
    ihencpyldkydegvmsatftdkvgcrydlgckgpmtmadcferkwnggvnwcvqnavci
    gcvepdfpdgkspfyqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5jsyA (A:)
    gtltgerppvfwlqgqgctgcsvtllnsvhpsiadvllkvislefhptvmawegehaieh
    mrkvaekfkgkfflviegsvpveadgkyciigeanhheismvdalkefgpnaaavlavgt
    caayggipaaegsetgatavskflgdngiktpvvnipgcpphpdwivgtvvlaldaikkn
    glegglaevvkvldsdgrptpffgrnihencpyldkydegvmsatftdkvgcrydlgckg
    pmtmadcferkwnggvnwcvqnavcigcvepdfpdgkspfyqa
    

  • Chain 'B':
    No sequence available.